| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp186532-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp186532-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $399.90 | |
| rp186532-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $639.90 | |
| rp186532-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,439.90 |
Carrier Free, ≥95% (SDS-PAGE), E. coli, No tag, 13-164 aa
| Product Name | Recombinant Mouse IL-36 gamma/IL-1F9 Protein |
|---|---|
| Grade | Carrier Free |
| Specifications & Purity | Carrier Free, ≥95%(SDS-PAGE), Lot by Lot |
| Biochemical and Physiological Mechanisms | IL-36 gamma [previously called IL-1F9, IL-1 epsilon (epsilon), and IL-1H1] is a member of the IL-1 family which includes IL‑1 beta, IL‑1 alpha, IL‑1ra, IL‑18, IL‑36 Ra (IL‑1F5), IL-36 alpha (IL‑1F6), IL‑36 beta (IL‑1F8), IL‑37 (IL‑1F7) and IL-1F10 (1-5). |
| Bioactivity | Testing in progress |
| Endotoxin Concentration | <1 EU/μg |
| Expression System | E. coli |
| Sequence | GRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS |
| Protein Tag | No tag |
| Predicted molecular weight | 13-164 aa |
| SDS-PAGE | 15.5 kDa, under reducing conditions; 15.4 & 32.6 kDa, under non-reducing conditions |
Recombinant Mouse IL-36 gamma/IL-1F9 Protein (rp186532) - SDS-PAGE
3 μg/lane of Recombinant Mouse IL-36 gamma/IL-1F9 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 15.5 kDa under reducing conditions and 15.4 & 32.6 kDa under non-reducing conditions.
| Concentration | Lot by Lot |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
