| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp154228-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $89.90 | |
| rp154228-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $239.90 | |
| rp154228-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,759.90 |
GMP, ≥95% (SDS-PAGE), Active, HEK293, C-His tag, 21-140 aa
| Product Name | Recombinant Mouse IL-4 Protein, ＞95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | B cell growth factor 1; BCDF; B-cell stimulatory factor 1; BCGF1; BCGF-1; binetrakin; BSF1; BSF-1; IL4; IL-4; IL-4B_cell stimulatory factor 1; IL4E12; interleukin 4; interleukin-4; Lymphocyte stimulatory factor 1; MGC79402; pitrakinra |
| Grade | Animal Free, Bioactive, Carrier Free, GMP, High performance |
| Product Description |
Purity |
| Specifications & Purity | Animal Free, Carrier Free, GMP, High performance, Bioactive, ≥95%(SDS-PAGE) |
| Purity | ＞95% (SDS-PAGE) |
| Bioactivity | Measured in a cell proliferation assay using assay using CTLL‑2 mouse cytotoxic T cells. The ED₅₀ for this effect is typically <1.8ng/mL. |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | HEK293 |
| Species | Mouse |
| Amino Acids | 21-140 aa |
| Sequence | HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYSGGGGSHHHHHHHHHH |
| Protein Tag | C-His |
| Protein Length | Full length protein |
| Accession # | P07750 |
| Source | Recombinant |
| Predicted molecular weight | 15.2 kDa |
Recombinant Mouse IL-4 Protein (rp154228)-Protein Bioactivity
Measured in a cell proliferation assay using assay using CTLL‑2 mouse cytotoxic T cells. The ED₅₀ for this effect is typically <1.8ng/mL.
Recombinant Mouse IL-4 Protein(rp154228)-SDS-PAGE
3μg/lane of Recombinant Mouse IL-4 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 18.2 kDa.
Recombinant Mouse IL-4 Protein (rp154228) - Protein Bioactivity
Measured in a cell proliferation assay using assay using NFS-60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is typically <1.8 ng/mL.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile H2O at not less than 100µg/ml, which can then be further diluted in other aqueous solutions. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20℃ for 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0607418 | Certificate of Analysis | Jun 28, 2024 | rp154228 |
| ZJ24F0607417 | Certificate of Analysis | Jun 28, 2024 | rp154228 |
| ZJ24F0606576 | Certificate of Analysis | Jun 07, 2024 | rp154228 |
| ZJ24F0606575 | Certificate of Analysis | Jun 07, 2024 | rp154228 |
| ZJ24F0606574 | Certificate of Analysis | Jun 07, 2024 | rp154228 |
| ZJ23F0901081 | Certificate of Analysis | Sep 18, 2023 | rp154228 |
| ZJ23F0901080 | Certificate of Analysis | Sep 18, 2023 | rp154228 |
| ZJ23F0400115 | Certificate of Analysis | Apr 29, 2023 | rp154228 |
| ZJ23F0400114 | Certificate of Analysis | Apr 29, 2023 | rp154228 |
