| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp154236-10μg | 10μg | In stock | $139.90 | |
| rp154236-50μg | 50μg | In stock | $349.90 | |
| rp154236-100μg | 100μg | In stock | $589.90 | |
| rp154236-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,569.90 | |
| rp154236-500μg | 500μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,749.90 |
Animal free, ＞96%(SDS-PAGE,HPLC), Active, E.coli, No tag, 25-211 aa
| Product Name | Recombinant Mouse IL-6 Protein, ＞96%(SDS-PAGE,HPLC), high purity |
|---|---|
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Interleukin-6 (IL-6) encoded by the IL-6 gene, acts as both a pro-inflammatory and anti-inflammatory cytokine. It is secreted by T cells and macrophages to stimulate immune response. IL-6 is a pleiotropic cytokine that plays an important role in host defense by regulating immune and inflammatory responses. It stimulates B cell differentiation and antibody production, synergizes with IL-3 in megakaryocyte development and platelet production, induces expression of hepatic acute-phase proteins, and regulates bone metabolism. IL-6 signals through the IL-6 receptor system that consists of two chains, IL-6R α and gp130. Murine IL-6 is inactive on human cells, while both human and murine are equally active on murine cells. Recombinant Murine IL-6 is a 21.7kDa globular protein containing 188 amino acid residues. Purity ＞96%(SDS-PAGE,HPLC) Function Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥96%(SDS-PAGE&HPLC) |
| Purity | ＞96%(SDS-PAGE,HPLC) |
| Bioactivity | Measured in a cell proliferation assay using M-NFS-60 mouse B cell. The ED₅₀ for this effect is less than 0.4 ng/mL. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | E.coli |
| Species | Mouse |
| Amino Acids | 25-211 aa |
| Sequence | MFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNG NSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYH SYLEYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPIS NALLTDKLESQKEWLRTKTIQFILKSLEEFLKVTLRSTRQT |
| Protein Tag | No tag |
| N-terminal Sequence | Met |
| Protein Length | Full length protein |
| Accession # | P08505 |
| Source | Recombinant |
| Predicted molecular weight | 21.7 kDa |
Recombinant Mouse IL-6 Protein (rp154236)-Protein Bioactivity
Measured in a cell proliferation assay using M-NFS-60 mouse B cell. The ED₅₀ for this effect is typically <0.4ng/mL.
Recombinant Mouse IL-6 Protein (rp154236)-SDS-PAGE
3μg/lane of Recombinant Mouse IL-6 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 20.1 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | 1、 This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2、 Reconstitute in a sterile aqueous buffer to an appropriate concentration. Stock solutions should be apportioned into working aliquots and stored at ≤ -20℃. F |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | For long term storage, the product should be stored ≤-20℃. 36 months for -20 to -70℃ as supplied; 1 month for 2 to 8℃ under sterile conditions after reconstitution; 3 months for -20 to -70℃ under sterile conditions after reconstitution. Please avoid rep |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0404263 | Certificate of Analysis | Apr 11, 2024 | rp154236 |
| ZJ24F0404262 | Certificate of Analysis | Apr 11, 2024 | rp154236 |
| ZJ24F0404261 | Certificate of Analysis | Apr 11, 2024 | rp154236 |
| ZJ23F0400120 | Certificate of Analysis | Apr 29, 2023 | rp154236 |
| ZJ23F0400118 | Certificate of Analysis | Apr 29, 2023 | rp154236 |
| ZJ23F0400119 | Certificate of Analysis | Apr 29, 2023 | rp154236 |
