Recombinant Mouse IL-6 Protein, >96%(SDS-PAGE,HPLC), high purity

Features and benefitsView More
  • Expression System: E.coli
  • Accession #: P08505
  • Protein Tag: No tag
  • Bioactivity: Measured in a cell proliferation assay using M-NFS-60 mouse B cell. The ED₅₀ for this effect is less than 0.4 ng/mL.
  • Endotoxin Concentration: <0.1 EU/μg
Item Number
rp154236
Grouped product items
SKUSizeAvailabilityPrice Qty
rp154236-10μg
10μg
In stock
$139.90
rp154236-50μg
50μg
In stock
$349.90
rp154236-100μg
100μg
In stock
$589.90
rp154236-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$2,569.90
rp154236-500μg
500μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$1,749.90

Animal free, >96%(SDS-PAGE,HPLC), Active, E.coli, No tag, 25-211 aa

Basic Description

Product NameRecombinant Mouse IL-6 Protein, >96%(SDS-PAGE,HPLC), high purity
GradeActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Product Description

Interleukin-6 (IL-6) encoded by the IL-6 gene, acts as both a pro-inflammatory and anti-inflammatory cytokine. It is secreted by T cells and macrophages to stimulate immune response. IL-6 is a pleiotropic cytokine that plays an important role in host defense by regulating immune and inflammatory responses. It stimulates B cell differentiation and antibody production, synergizes with IL-3 in megakaryocyte development and platelet production, induces expression of hepatic acute-phase proteins, and regulates bone metabolism. IL-6 signals through the IL-6 receptor system that consists of two chains, IL-6R α and gp130. Murine IL-6 is inactive on human cells, while both human and murine are equally active on murine cells. Recombinant Murine IL-6 is a 21.7kDa globular protein containing 188 amino acid residues.


Purity

>96%(SDS-PAGE,HPLC)


Function

Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. 

Specifications & PurityActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥96%(SDS-PAGE&HPLC)
Purity>96%(SDS-PAGE,HPLC)
BioactivityMeasured in a cell proliferation assay using M-NFS-60 mouse B cell. The ED₅₀ for this effect is less than 0.4 ng/mL.
Endotoxin Concentration<0.1 EU/μg
Expression SystemE.coli
SpeciesMouse
Amino Acids25-211 aa
SequenceMFPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNG NSDCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYH SYLEYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPIS NALLTDKLESQKEWLRTKTIQFILKSLEEFLKVTLRSTRQT
Protein TagNo tag
N-terminal Sequence Met
Protein LengthFull length protein
Accession #P08505
SourceRecombinant
Predicted molecular weight21.7 kDa

Images

Recombinant Mouse IL-6 Protein (rp154236)-Protein Bioactivity
Measured in a cell proliferation assay using M-NFS-60 mouse B cell. The ED₅₀ for this effect is typically <0.4ng/mL.

Recombinant Mouse IL-6 Protein (rp154236)-SDS-PAGE
3μg/lane of Recombinant Mouse IL-6 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 20.1 kDa.

Product Specifications

FormLyophilized
Reconstitution1、 This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2、 Reconstitute in a sterile aqueous buffer to an appropriate concentration. Stock solutions should be apportioned into working aliquots and stored at ≤ -20℃. F
Storage TempStore at -20°C,Avoid repeated freezing and thawing
Shipped InIce chest + Ice pads
Stability And StorageFor long term storage, the product should be stored ≤-20℃. 36 months for -20 to -70℃ as supplied; 1 month for 2 to 8℃ under sterile conditions after reconstitution; 3 months for -20 to -70℃ under sterile conditions after reconstitution. Please avoid rep

Certificates

C of A & Other Certificates(BSE/TSE, COO)

Find and download the COA for your product by matching the lot number on the packaging.

6 results found

Lot NumberCertificate TypeDateItem
ZJ24F0404263Certificate of AnalysisApr 11, 2024 rp154236
ZJ24F0404262Certificate of AnalysisApr 11, 2024 rp154236
ZJ24F0404261Certificate of AnalysisApr 11, 2024 rp154236
ZJ23F0400120Certificate of AnalysisApr 29, 2023 rp154236
ZJ23F0400118Certificate of AnalysisApr 29, 2023 rp154236
ZJ23F0400119Certificate of AnalysisApr 29, 2023 rp154236

Related Documents

Solution Calculators