| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp154305-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $79.90 | |
| rp154305-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $219.90 | |
| rp154305-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $359.90 | |
| rp154305-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,399.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 24-203 aa
| Product Name | Recombinant Mouse LIF Protein, ＞95% SDS-PAGE, high purity |
|---|---|
| Synonyms | CDF | D Factor | DIA | differentiation inhibitory activity | differentiation stimulating factor | Differentiation-stimulating factor | Emfilermin | HILDA | HILDAcholinergic differentiation factor | leukemia inhibitory factor (cholinergic differentiation f |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ＞95% SDS-PAGE |
| Bioactivity | Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 85.14 ng/mL. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Species | Mouse |
| Amino Acids | 24-203 aa |
| Sequence | SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAFHHHHHH |
| Protein Tag | C-His |
| Accession # | P09056 |
| Predicted molecular weight | 20.7 kDa |
| SDS-PAGE | 38 - 48 kDa, under reducing conditions; 38 -48 kDa, under non-reducing conditions. |
Recombinant Mouse LIF Protein (rp154305) - Protein Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 85.14 ng/mL.
Recombinant Mouse LIF Protein (rp154305) - SDS-PAGE
3 μg/lane of Recombinant Mouse LIF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 38 - 48 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
