| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp154365-100μg | 100μg | In stock | $1,099.90 |
>90% SDS-PAGE, Active, 293F, His-tag, 33-262 aa
| Product Name | Recombinant Mouse M-CSF Protein, ＞90% SDS-PAGE, high purity |
|---|---|
| Synonyms | Colony stimulating factor 1 | Colony stimulating factor 1 (macrophage) | Colony stimulating factor macrophage specific CSF 1 | CSF-1 | CSF1 | CSF1_HUMAN | Csfm Lanimostim | M CSF | M-CSF | Macrophage colony stimulating factor | Macrophage Colony Stimulati |
| Grade | ActiBioPure™, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity ≥ 95% SDS-PAGE. Purified using standard chromatographical techniques. Function Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. CSF-1 induces cells of the monocyte/macrophage lineage. It plays a role in immunological defenses, bone metabolism, lipoproteins clearance, fertility and pregnancy. Post-translational Glycosylation and proteolytic cleavage yield different soluble forms. A high molecular weight soluble form is a proteoglycan containing chondroitin sulfate. Isoform 1 is N- and O-glycosylated. Isoform 3 is N-glycosylated. |
| Specifications & Purity | ActiBioPure™, Bioactive, Carrier Free, Azide Free, ≥90%(SDS-PAGE) |
| Purity | ＞90% SDS-PAGE |
| Bioactivity | Recombinant Mouse M-CSF Protein has been identified as an interactor of M-CSF, a binding ELISA assay was conducted to detect the interaction of recombinant mouse M-CSF and recombinant mouse MCSFR. |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | HEK293 |
| Species | Mouse |
| Amino Acids | 33-262 aa |
| Sequence | KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQ ELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYP KATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE |
| Protein Tag | N-His |
| Protein Length | Protein fragment |
| Accession # | P07141 |
| Source | Recombinant |
| Predicted molecular weight | 29.7kDa |
| SDS-PAGE | 46.7-64.6 kDa, under reducing conditions; 76.9-119.0 kDa, under non-reducing conditions. |
| Note | 卖完停产，不再备货 |
Recombinant Mouse M-CSF Protein (rp154365)-Protein Bioactivity
Recombinant Mouse M-CSF Protein has been identified as an interactor of M-CSF, a binding ELISA assay was conducted to detect the interaction of recombinant mouse M-CSF and recombinant mouse MCSFR.
Recombinant Mouse M-CSF Protein (rp154365)-SDS-PAGE
8μg/lane of Recombinant Mouse M-CSF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining. Showing the band at 46.7-64.6 kDa under reducing conditions and 76.9-119.0 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex |
| Storage Temp | Store at -20°C |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0404266 | Certificate of Analysis | Apr 11, 2024 | rp154365 |
| ZJ24F0404265 | Certificate of Analysis | Apr 11, 2024 | rp154365 |
| ZJ24F0404264 | Certificate of Analysis | Apr 11, 2024 | rp154365 |
| ZJ23F0500259 | Certificate of Analysis | Jun 12, 2023 | rp154365 |
| ZJ23F0600283 | Certificate of Analysis | Jun 12, 2023 | rp154365 |
