| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp154395-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp154395-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $599.90 | |
| rp154395-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,099.90 | |
| rp154395-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $3,399.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 20-730 aa
| Product Name | Recombinant Mouse MMP-9 Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | Matrix Metalloproteinase 9 | 92 kDa gelatinase | 92 kDa type IV collagenase | CLG4B | EC 3.4.24 | EC 3.4.24.35 | Gelatinase B | GELB | macrophage gelatinase | MANDP2 | matrix metallopeptidase 9 | matrix metalloproteinase-9 | MMP9 | MMP-9 | type V collagen |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Measured by its ability to cleave the fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2. The specific activity is >1900 pmol/min/μg. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Species | Mouse |
| Amino Acids | 20-730 aa |
| Sequence | APYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCPHHHHHH |
| Protein Tag | C-His |
| Accession # | P41245-1 |
| Predicted molecular weight | 79.4 kDa |
| SDS-PAGE | 100 - 110 kDa, under reducing conditions; 100 - 110 kDa, under non-reducing conditions. |
| Note | 20μg卖完停产，不再备货 |
Recombinant Mouse MMP-9 Protein (rp154395) - SDS-PAGE
3 μg/lane of Recombinant Mouse MMP-9 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 100 - 110 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0607406 | Certificate of Analysis | Jun 28, 2024 | rp154395 |
| ZJ24F0607405 | Certificate of Analysis | Jun 28, 2024 | rp154395 |
| ZJ24F0607404 | Certificate of Analysis | Jun 28, 2024 | rp154395 |
