Skip to the beginning of the images gallery

Recombinant Mouse MMP-9 Protein, ≥95% (SDS-PAGE), high purity

≥95%(SDS-PAGE)

Features and benefits

Expression System: HEK293
Accession #: P41245-1
Protein Tag: C-His
Bioactivity: Measured by its ability to cleave the fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2. The specific activity is >1900 pmol/min/μg.
Endotoxin Concentration: ＜0.1 EU/μg

Item Number

rp154395

Grouped product items
SKU	Size	Availability	Price
rp154395-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$139.90
rp154395-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$599.90
rp154395-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$1,099.90
rp154395-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$3,399.90

Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 20-730 aa

View related series

Click to view protein information: MMP9

Accession#: P41245 Gene ID: 17395 MMP9

Basic Description

Product Name	Recombinant Mouse MMP-9 Protein, ≥95% (SDS-PAGE), high purity
Synonyms	Matrix Metalloproteinase 9 \| 92 kDa gelatinase \| 92 kDa type IV collagenase \| CLG4B \| EC 3.4.24 \| EC 3.4.24.35 \| Gelatinase B \| GELB \| macrophage gelatinase \| MANDP2 \| matrix metallopeptidase 9 \| matrix metalloproteinase-9 \| MMP9 \| MMP-9 \| type V collagen
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
Product Description	Purity ≥95% SDS-PAGE. Endotoxin level <0.1 EU/µg Function May play an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly- -Leu bond. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity	≥95% (SDS-PAGE)
Bioactivity	Measured by its ability to cleave the fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2. The specific activity is >1900 pmol/min/μg.
Endotoxin Concentration	＜0.1 EU/μg
Expression System	HEK293
Species	Mouse
Amino Acids	20-730 aa
Sequence	APYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSE
Protein Tag	C-His
Accession #	P41245-1
Predicted molecular weight	79.4 kDa
SDS-PAGE	100-110 kDa under reducing conditions.

Product Specifications

Form	Lyophilized
Reconstitution	Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle.

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0607406	Certificate of Analysis	Jun 28, 2024	rp154395
ZJ24F0607405	Certificate of Analysis	Jun 28, 2024	rp154395
ZJ24F0607404	Certificate of Analysis	Jun 28, 2024	rp154395

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.