| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp154630-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $139.90 | |
| rp154630-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $299.90 | |
| rp154630-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $499.90 | |
| rp154630-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,059.90 |
Carrier Free, >97% (SDS-PAGE,HPLC), Active, E. coli, No tag, 26-190 aa
| Product Name | Recombinant Mouse SCF Protein, ＞97% (SDS-PAGE,HPLC), high purity |
|---|---|
| Grade | ActiBioPure™, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Stem Cell Factor (SCF) which binds to the c-Kit receptor is produced by fibroblasts and endothelial cells. The soluble and transmembrane forms of the protein are formed by alternative splicing of the same RNA transcript and the presence of both soluble and transmembrane It is required for normal hematopoietic function and plays an important role in hematopoiesis, spermatogenesis, and melanogenesis. It also promotes mast cell adhesion, migration, proliferation, and survival. Human SCF manifests low activity on murine cells, while murine and rat SCF are fully active on human cells. Recombinant murine SCF is an 18.4kDa polypeptide containing 165 amino acid residues. Purity ＞97% (SDS-PAGE,HPLC) Function Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins. Post-translational A soluble form (sKITLG) is produced by proteolytic processing of isoform 1 in the extracellular domain. Found in two differentially glycosylated forms, LMW-SCF and HMW-SCF. LMW-SCF is fully N-glycosylated at Asn-145, partially N-glycosylated at Asn-90, O-glycosylated at Ser-167, Thr-168 and Thr-180, and not glycosylated at Asn-97 or Asn-118. HMW-SCF is N-glycosylated at Asn-118, Asn-90 and Asn-145, O-glycosylated at Ser-167, Thr-168 and Thr-180, and not glycosylated at Asn-97. A soluble form exists as a cleavage product of the extracellular domain. |
| Specifications & Purity | ActiBioPure™, Bioactive, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC) |
| Purity | ＞97% (SDS-PAGE,HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The ED₅₀ as determined by a cell proliferation assay using human TF-1 cells is less than 10 ng/ml, corresponding to a specific activity of >1.0 ×10⁵ IU/mg. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | E.coli |
| Species | Mouse |
| Amino Acids | 26-190 aa |
| Sequence | MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWL RDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENA PKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTL GPEKDSRVSVTKPFMLPPVA |
| Protein Tag | No tag |
| N-terminal Sequence | Met |
| Accession # | P20826 |
| Predicted molecular weight | 18.4 kDa |
| SDS-PAGE | 16.6 kDa, under reducing conditions; 12.9 kDa, under non-reducing conditions. |
Recombinant Mouse SCF Protein (rp154630) - Protein Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is typically less than 10 ng/mL.
Recombinant Mouse SCF Protein (rp154630)- SDS-PAGE
2.5 μg/lane of Recombinant Mouse SCF was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 16.6 kDa under reducing conditions and 12.9 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in a sterile aqueous buffer to an appropriate concentration. Stock solutions should be a pportioned into working aliquots and stored at ≤ -20°C. Furth |
| Storage Temp | Store at -80°C |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | For long term storage, the product should be stored ≤ -20°C. Please avoid repeated freeze-thaw cycles after reconstitution. 36 months at -20 to -70 °C; 1 month at 2 to 8°C. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0800928 | Certificate of Analysis | Aug 30, 2023 | rp154630 |
| ZJ23F0800930 | Certificate of Analysis | Aug 30, 2023 | rp154630 |
| ZJ23F0800929 | Certificate of Analysis | Aug 30, 2023 | rp154630 |
