| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp154717-10μg | 10μg | In stock | $139.90 | |
| rp154717-50μg | 50μg | In stock | $459.90 | |
| rp154717-100μg | 100μg | In stock | $729.90 | |
| rp154717-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $3,679.90 |
Animal Free, >90% (SDS-PAGE), Active, HEK293, N-His tag, 22-356 aa
| Product Name | Recombinant Mouse Thrombopoietin Protein, >90% (SDS-PAGE), high purity |
|---|---|
| Synonyms | Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; megakaryocyte stimulating factor; MGDF; MGDFC-mpl ligand; MKCSF; MK-CSF; ML; MPL ligand; MPLLG; MPLLGMGC163194; Myeloproliferative leukemia virus oncogene ligand; THCYT1 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥90%(SDS-PAGE) |
| Purity | >90% (SDS-PAGE) |
| Bioactivity | Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED₅₀ for this effect is typically 0.35 ng/mL. |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | HEK293 |
| Species | Mouse |
| Amino Acids | 22-356 aa |
| Sequence | SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSRLQGFRVKITPGQLNQTSRSPVQISGYLNRTHGPVNGTHGLFAGTSLQTLEASDIS |
| Protein Tag | N-His |
| Accession # | P40226 |
| Predicted molecular weight | 37 kDa |
| SDS-PAGE | 89.5 kDa, under reducing conditions; 89.5 kDa, under non-reducing conditions. |
Recombinant Mouse Thrombopoietin Protein (rp154717) - Protein Bioactivity
Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED₅₀ for this effect is typically 0.35 ng/mL.
Recombinant Mouse Thrombopoietin Protein (rp154717) - SDS-PAGE
3 μg/lane of Recombinant Mouse Thrombopoietin Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 89.5 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25mg/mL. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store it under sterile conditions at -20℃ to -80℃ upon receiving. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1101645 | Certificate of Analysis | Nov 20, 2023 | rp154717 |
| ZJ23F1101644 | Certificate of Analysis | Nov 20, 2023 | rp154717 |
| ZJ23F1101643 | Certificate of Analysis | Nov 20, 2023 | rp154717 |
