Skip to the beginning of the images gallery

Recombinant Mouse Thrombopoietin Protein, >90% (SDS-PAGE), high purity

≥90%(SDS-PAGE)

Features and benefits

Expression System: HEK293
Accession #: P40226
Protein Tag: N-His
Bioactivity: Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED₅₀ for this effect is typically 0.35 ng/mL.
Endotoxin Concentration: ＜1.0 EU/μg

Item Number

rp154717

Grouped product items
SKU	Size	Availability	Price
rp154717-10μg	10μg	In stock	$139.90
rp154717-50μg	50μg	In stock	$459.90
rp154717-100μg	100μg	In stock	$729.90
rp154717-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$3,679.90

Animal Free, >90% (SDS-PAGE), Active, HEK293, N-His tag, 22-356 aa

View related series

Click to view protein information: THPO

Accession#:P40226 Gene ID:21832 THPO Thrombopoietin

Basic Description

Product Name	Recombinant Mouse Thrombopoietin Protein, >90% (SDS-PAGE), high purity
Synonyms	Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; megakaryocyte stimulating factor; MGDF; MGDFC-mpl ligand; MKCSF; MK-CSF; ML; MPL ligand; MPLLG; MPLLGMGC163194; Myeloproliferative leukemia virus oncogene ligand; THCYT1
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Product Description	Purity >90% SDS-PAGE . Function Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥90%(SDS-PAGE)
Purity	>90% (SDS-PAGE)
Bioactivity	Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED₅₀ for this effect is typically 0.35 ng/mL.
Endotoxin Concentration	＜1.0 EU/μg
Expression System	HEK293
Species	Mouse
Amino Acids	22-356 aa
Sequence	SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKFPNRTSGLLETNFSVTARTAGPGLLSRLQGFRVKITPGQLNQTSRSPVQISGYLNRTHGPVNGTHGLFAGTSLQTLEASDIS
Protein Tag	N-His
Accession #	P40226
Predicted molecular weight	37 kDa
SDS-PAGE	89.5 kDa, under reducing conditions; 89.5 kDa, under non-reducing conditions.

Images

Recombinant Mouse Thrombopoietin Protein (rp154717) - Protein Bioactivity
Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED₅₀ for this effect is typically 0.35 ng/mL.

Recombinant Mouse Thrombopoietin Protein (rp154717) - SDS-PAGE
3 μg/lane of Recombinant Mouse Thrombopoietin Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 89.5 kDa.

Product Specifications

Form	Lyophilized
Reconstitution	It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25mg/mL.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store it under sterile conditions at -20℃ to -80℃ upon receiving. Upon delivery aliquot. Avoid freeze/thaw cycle.

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number	Certificate Type	Date	Item
ZJ23F1101645	Certificate of Analysis	Nov 20, 2023	rp154717
ZJ23F1101644	Certificate of Analysis	Nov 20, 2023	rp154717
ZJ23F1101643	Certificate of Analysis	Nov 20, 2023	rp154717

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.