| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp154759-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $359.90 | |
| rp154759-20μg | 20μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $534.90 | |
| rp154759-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $299.90 | |
| rp154759-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $1,101.90 | |
| rp154759-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $7,184.90 |
Animal Free, >97% (SDS-PAGE; HPLC ), Active, E.coli, No tag, 80-235aa
| Product Name | Recombinant Mouse TNF-alpha Protein, ＞97% (SDS-PAGE; HPLC ), high purity |
|---|---|
| Synonyms | Recombinant Murine Tumor Necrosis Factor alpha (rMuTNF-α) ； APC1 protein; Cachectin; Cachetin; DIF; TNF; TNF, monocyte-derived; TNFA; TNF-A; TNFalpha; TNF-alpha; TNF-alphacachectin; TNFATNF, macrophage-derived; TNFG1F; TNFSF1A; TNFSF2; TNFSF2TNF superfami |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC) |
| Purity | ＞97% (SDS-PAGE; HPLC ) |
| Biological Activity | Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D (Catalog # A113142). The ED₅₀ for this effect is typically <0.1 ng/mL. |
| Species | Mouse |
| Amino Acids | 80-235aa |
| Sequence | MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYL VYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPI YLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL |
| Protein Tag | No tag |
| Protein Length | Protein fragment |
| Accession # | P06804 |
| Source | Recombinant |
| Predicted molecular weight | 17.4 kDa |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance |
Recombinant Mouse TNF-alpha Protein (rp154759)-Protein Bioactivity
Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D (Catalog # A113142). The EC₅₀ for this effect is typically <0.1ng/mL.
Recombinant Mouse TNF-alpha Protein (rp154759)-SDS-PAGE
3μg/lane of Recombinant Mouse TNF-alpha was resolved with SDS-PAGE under reducing (R) conditions and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 16.3 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | 1.This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in a sterile aqueous buffer to an appropriate concentration。 Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. F |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Dry ice |
| Stability And Storage | Upon delivery aliquot, Store at -20°C, Avoid freeze / thaw cycles. Lyophilized with no additives. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1101718 | Certificate of Analysis | Nov 20, 2023 | rp154759 |
| ZJ23F1101717 | Certificate of Analysis | Nov 20, 2023 | rp154759 |
| ZJ23F0300080 | Certificate of Analysis | Mar 25, 2023 | rp154759 |
| ZJ23F0300081 | Certificate of Analysis | Mar 25, 2023 | rp154759 |
| ZJ23F0300082 | Certificate of Analysis | Mar 25, 2023 | rp154759 |
