| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp154759-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $99.90 | |
| rp154759-20μg | 20μg | In stock | $159.90 | |
| rp154759-50μg | 50μg | In stock | $299.90 | |
| rp154759-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $449.90 | |
| rp154759-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,569.90 |
Animal Free, >97% (SDS-PAGE; HPLC ), Active, E.coli, No tag, 80-235aa
| Product Name | Recombinant Mouse TNF-alpha Protein, ＞97% (SDS-PAGE; HPLC ), high purity |
|---|---|
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity >97% (SDS-PAGE; HPLC). Purity is greater than 97% as determined by SEC-HPLC and reducing SDS-PAGE. Additional sequence information NP_038721. Mature protein; soluble form. Function Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Post-translational The soluble form derives from the membrane form by proteolytic processing. The membrane form, but not the soluble form, is phosphorylated on serine residues. Dephosphorylation of the membrane form occurs by binding to soluble TNFRSF1A/TNFR1. O-glycosylated; glycans contain galactose, N-acetylgalactosamine and N-acetylneuraminic acid. Tumor necrosis factor alpha (TNF-α), also called Cachectin, is the best-know member of the TNF-family, which can cause cell death. This protein is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes endothelial cells, smooth muscle cells and some transformed cells. The naturally-occurring form of TNF-α is glycosylated, but non-glycosylated recombinant TNF-α has comparable biological activity. Human and murine TNF-α show approximately 79 % homology at the amino acid level and cross-reactivity between the two species. Two types of receptors for TNF-α have been described and virtually all cell types studied show the presence of one or both of these receptor types. The recombinant Murine TNF-α is a non-glycosylated polypeptide chain containing 157 amino acids |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC) |
| Purity | ＞97% (SDS-PAGE; HPLC ) |
| Bioactivity | Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D (Catalog # A113142). The ED₅₀ for this effect is typically <0.1 ng/mL. |
| Endotoxin Concentration | <0.01 EU/μg |
| Expression System | E.coli |
| Species | Mouse |
| Amino Acids | 80-235aa |
| Sequence | MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYL VYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPI YLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL |
| Protein Tag | No tag |
| Protein Length | Protein fragment |
| Accession # | P06804 |
| Source | Recombinant |
| Predicted molecular weight | 17.4 kDa |
Recombinant Mouse TNF-alpha Protein (rp154759)-Protein Bioactivity
Measured in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D (Catalog # A113142). The EC₅₀ for this effect is typically <0.1ng/mL.
Recombinant Mouse TNF-alpha Protein (rp154759)-SDS-PAGE
3μg/lane of Recombinant Mouse TNF-alpha was resolved with SDS-PAGE under reducing (R) conditions and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 16.3 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | 1.This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in a sterile aqueous buffer to an appropriate concentration。 Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. F |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Upon delivery aliquot, Store at -20°C, Avoid freeze / thaw cycles. Lyophilized with no additives. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1101718 | Certificate of Analysis | Nov 20, 2023 | rp154759 |
| ZJ23F1101717 | Certificate of Analysis | Nov 20, 2023 | rp154759 |
| ZJ23F0300080 | Certificate of Analysis | Mar 25, 2023 | rp154759 |
| ZJ23F0300081 | Certificate of Analysis | Mar 25, 2023 | rp154759 |
| ZJ23F0300082 | Certificate of Analysis | Mar 25, 2023 | rp154759 |
