| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp154577-2μg | 2μg | In stock | $59.90 | |
| rp154577-10μg | 10μg | In stock | $139.90 | |
| rp154577-50μg | 50μg | In stock | $449.90 | |
| rp154577-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,449.90 |
Animal Free, >95%(SDS-PAGE), Active, 293F, Fc, 72-316aa
| Product Name | Recombinant Mouse TRANCE/RANKL/TNFSF11 Protein, ＞95%(SDS-PAGE), high purity |
|---|---|
| Synonyms | CD254 antigen; CD254; ODF; OPGL; OPGLOPTB2; Osteoclast differentiation factor; Osteoprotegerin ligand; RANK L; RANKL; RANKLreceptor activator of nuclear factor kappa B ligand; Receptor activator of nuclear factor kappa-B ligand; sOdf; TNF-related activati |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity ＞95% SDS-PAGE. Actual molecular weight 19 kDa Additional sequence information Soluble Receptor Activator of NFkB Ligand Function Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy. Post-translational The soluble form of isoform 1 derives from the membrane form by proteolytic processing (By similarity). The cleavage may be catalyzed by ADAM17. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ＞95%(SDS-PAGE) |
| Bioactivity | Measured by its ability to induce TRAP activity in Raw 264.7 cells.The ED50 of each lot is between 2-10 ng/mL. |
| Endotoxin Concentration | ＜0.01 EU/μg |
| Expression System | HEK293 |
| Species | Mouse |
| Amino Acids | 72-316 aa |
| Sequence | MPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKRAQMDPNRISEDSTHCFYRILRL |
| Protein Tag | N-Met & Fc |
| Accession # | O35235 |
| Predicted molecular weight | 56kDa |
Recombinant Mouse TRANCE/RANK L/TNFSF11 Protein (rp154577) - Protein Bioactivity
Measured by its ability to induce TRAP activity in Raw 264.7 cells. The ED₅₀ of this effect is 7.0 ng/mL.
Recombinant Mouse TRANCE/RANK L/TNFSF11 Protein (rp154577) - SDS-PAGE
2.5 μg/lane of Recombinant Mouse TRANCE/RANK L/TNFSF11 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 57.4 kDa under reducing condition and 114.0 kDa under non-reducing condition.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in water to a concentration of 0.1-1.0 mg/ml |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0607412 | Certificate of Analysis | Jun 28, 2024 | rp154577 |
| ZJ24F0607411 | Certificate of Analysis | Jun 28, 2024 | rp154577 |
| ZJ24F0607410 | Certificate of Analysis | Jun 28, 2024 | rp154577 |
| ZJ23F1101629 | Certificate of Analysis | Nov 20, 2023 | rp154577 |
| ZJ23F1101630 | Certificate of Analysis | Nov 20, 2023 | rp154577 |
| ZJ23F1101631 | Certificate of Analysis | Nov 20, 2023 | rp154577 |
