| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp155836-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $59.90 | |
| rp155836-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $269.90 | |
| rp155836-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,279.90 |
Carrier free, >95% (SDS-PAGE), E. coli, His tag, 1-110 aa
| Product Name | Recombinant MPXV A29L Protein, ＞95% (SDS-PAGE), high purityused for WB,ELISA various applications |
|---|---|
| Synonyms | OPG154; A29L; IMV surface protein A29L; Monkeypox virus; Monkeypox virus A29L |
| Grade | Azide Free, Carrier Free |
| Product Description | Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining. |
| Specifications & Purity | Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ＞95% (SDS-PAGE) |
| Expression System | E. coli |
| Species | Monkeypox virus |
| Amino Acids | 1-110 aa |
| Sequence | MGSSHHHHHHSSGLVPRGSHMDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE |
| Protein Tag | N-His |
| Protein Length | Full length protein |
| Accession # | Q77HM6 |
| Source | Recombinant |
| Predicted molecular weight | 14.7 kDa |
| SDS-PAGE | 13.2 kDa, under reducing conditions; 37-46 kDa, under non-reducing conditions |
Recombinant MPXV A29L Protein (rp155836) - SDS-PAGE
3 μg/lane of Recombinant MPXV A29L Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining. Showing a band at 13.2 kDa under reducing conditions and 37-46 kDa under non-reducing conditions.
| Application | WB,ELISA |
|---|---|
| Form | Lyophilized |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C stable for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0700584 | Certificate of Analysis | Jul 14, 2023 | rp155836 |
