Recombinant MPXV E8L Protein, >95% (SDS-PAGE), high purity

Item Number

rp155937

• Product Name: Recombinant MPXV E8L Protein, >95% (SDS-PAGE), high purity
• Synonyms: Cell surface-binding protein OPG105 | Carbonic anhydrase homolog | E8L | IMV membrane protein E8L | Cell surface-binding protein OPG105 | Carbonic anhydrase homolog | E8L | IMV membrane protein E8L
• Grade: Animal Free, Azide Free, Carrier Free
• Specifications & Purity: Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
• Purity: >95% (SDS-PAGE)
• Endotoxin Concentration: <1.0 EU/μg
• Expression System: HEK293
• Amino Acids: 1-275 aa
• Sequence: MPQQLSPINIETKKAISDTRLKTLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNEYVLSTIHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGIIIIAIFLQVSDHKNVYFQKIVNQLDSIRSANMSAPFDSVFYLDNLLPSTLDYFTYLGTTINHSADAAWIIFPTPINIHSDQLSKFRTLLSSSNHEGKPHYITENYRNPYKLNDDTQVYYSGEIIRAATTSPVRENYFMKWLSDLREACFSYYQKYIEGNKTENLYFQGHHHHHH
• Protein Tag: C-His
• Predicted molecular weight: 35.8 kDa
• SDS-PAGE: 35-55 and 65-100 kDa, under reducing conditions; 35-55 and 65-100 kDa, under non-reducing conditions

Product Description

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Desscription:
Monkeypox Virus (MPXV), the virus that causes monkeypox infection in both humans and animals, is a double-stranded DNA virus that had a recent global outbreak in 2022. MPXV belongs to the Poxviridae family of viruses. It consists of several key subunits including a surface membrane fusion protein (A29L, ~14 kDa), two separate envelope proteins (A30L ~14 kDa and H3L ~32kDa), an envelope glycoprotein, (A35R ~15 kDa), a receptor glycoprotein that mimics IFN‑alpha/beta (B16, ~37kDa), a palmitoylated EEV membrane glycoprotein (C19L, ~35 kDa), a secreted IL-18 binding protein (D6L, ~14kDa), a cell surface-binding protein (E8L, ~32 kDa), a telomere binding protein (I1L, ~36kDa), and a subunit required for DNA packaging (L1R, 18 kDa). The E8L subunit in MPXV is a surface binding protein that plays a key role in viral entry. This happens with E8L binding to chondroitin sulfate on the surface of cells, giving MPXV virion attachment to the host cell. In infected samples, E8L is identified in abundance with intracellular proteins. When targeting the E8L subunit, transmission and replication was reduced by 78% when treated with 100 nM of small interference RNA (siRNA) and reduced by 95% when treated with 200 nM of siRNA. The E8L subunit is the most promising target for a newer, more effective vaccine against MPXV, as it has been found to contain human-foreign pentapeptides that could contain epitopes that would be viable for MPXV vaccinations.