| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp155935-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | In stock | $129.90 | |
| rp155935-50μg | 50μg | In stock | $419.90 | |
| rp155935-100μg | 100μg | In stock | $659.90 | |
| rp155935-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,599.90 |
Animal Free, >95% (SDS-PAGE), 293 cell, C-His tag, 1-183 aa
| Product Name | Recombinant MPXV M1R Protein |
|---|---|
| Synonyms | Monkeypox Virus; MPV; Monkeypox virus; MPXV; M1R; IMV membrane protein M1R |
| Grade | Animal Free, Azide Free, Carrier Free |
| Product Description | Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description： |
| Specifications & Purity | Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Expression System | HEK293 |
| Amino Acids | 1-183 aa |
| Sequence | MGAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNITVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTGENLYFQGHHHHHH |
| Protein Tag | C-His |
| Predicted molecular weight | 33.9 kDa |
| SDS-PAGE | 22-37 kDa, reducing conditions; 22-37 kDa, non-reducing conditions |
Recombinant MPXV M1R Protein (rp155935) - SDS-PAGE
3 μg/lane of Recombinant MPXV M1R Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining. Showing a band at 22-37 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1101736 | Certificate of Analysis | Nov 20, 2023 | rp155935 |
| ZJ23F1101735 | Certificate of Analysis | Nov 20, 2023 | rp155935 |
| ZJ23F1101734 | Certificate of Analysis | Nov 20, 2023 | rp155935 |
| ZJ23R1100130 | Certificate of Analysis | Nov 14, 2023 | rp155935 |
