Click Here for 5% Off Your First Aladdin Purchase!

Recombinant Rat GM-CSF Protein, >98% (SDS-PAGE, HPLC), high purity(Active)

Features and benefits
  • Specifications & Purity: ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥98%(SDS-PAGE&HPLC)
  • Biological Activity: Measured in a cell proliferation assay using murine FDC-P1 cells. The ED50 for this effect is typically <0.01ng/mL.
  • Protein Tag: No tag
Item Number
rp155067
Grouped product items
SKUSizeAvailabilityPrice Qty
rp155067-10μg (Trial Size)
Apply for free trial size(?)
Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free!
10μg
Available within 4-8 weeks(?)
Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!
$168.90
rp155067-50μg
50μg
Available within 4-8 weeks(?)
Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!
$434.90
rp155067-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$5,568.90

Animal Free, >98% (SDS-PAGE, HPLC), Active, E. coli, No tag, 18-144 aa

Basic Description

Product NameRecombinant Rat GM-CSF Protein, >98% (SDS-PAGE, HPLC), high purity
SynonymsColony stimulating factor 2 (granulocyte-macrophage); Colony-stimulating factor; CSF; CSF2; CSF-2; GMCSF; GM-CSF; GMCSF; granulocyte-macrophage colony-stimulating factor; granulocyte-macrophage colony stimulating factor; MGC131935; MGC138897; Molgramosti
Specifications & PurityActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥98%(SDS-PAGE&HPLC)
Purity>98% (SDS-PAGE, HPLC)
Biological ActivityMeasured in a cell proliferation assay using murine FDC-P1 cells. The ED50 for this effect is typically <0.01ng/mL.
SpeciesRat
Amino Acids18 to 144
SequenceAPTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSI QRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCE IEVTTFEDFIKNLKGFLFDIPFDCWKPVQK
Protein TagNo tag
Protein LengthFull length protein
Accession #P48750
SourceRecombinant
Predicted molecular weight14.5 kDa
SDS-PAGE13.7 kDa, under reducing conditions; 13.7 kDa, under non-reducing conditions.
GradeActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance

Images

Recombinant Rat GM-CSF Protein (rp155067)-Protein Bioactivity
Measured in a cell proliferation assay using FDC-P1 cells. The ED₅₀ for this effect is typically <0.01ng/mL.

Recombinant Rat GM-CSF Protein (rp155067)-SDS-PAGE
3μg/lane of Recombinant Rat GM-CSF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 13.7 kDa.

Product Specifications

FormLyophilized
Reconstitution1.This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in a sterile aqueous buffer to an appropriate concentration. Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. F
Storage TempStore at -20°C,Avoid repeated freezing and thawing
Shipped InDry ice
Stability And StorageUpon delivery aliquot, Store at -20°C, Avoid freeze / thaw cycles.

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section

2 results found

Lot NumberCertificate TypeDateItem
ZJ23F0600299Certificate of AnalysisJun 09, 2023 rp155067
ZJ23F0600298Certificate of AnalysisJun 09, 2023 rp155067

Related Documents

Product Questions

Product Questions

Sign In Hover me Please sign in to submit a question
No questions yet. Be the first to ask the question!

Reviews

Customer Reviews

Calculator