Calculate the mass, volume, or concentration required for a solution.
Recombinant Rat GM-CSF Protein (rp155067)-Protein Bioactivity
Measured in a cell proliferation assay using FDC-P1 cells. The ED₅₀ for this effect is typically <0.01ng/mL.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp155067-10μg (Trial Size) Apply for free trial size(?) Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $168.90 | |
rp155067-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $434.90 | |
rp155067-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $5,568.90 |
Animal Free, >98% (SDS-PAGE, HPLC), Active, E. coli, No tag, 18-144 aa
Product Name | Recombinant Rat GM-CSF Protein, >98% (SDS-PAGE, HPLC), high purity |
---|---|
Synonyms | Colony stimulating factor 2 (granulocyte-macrophage); Colony-stimulating factor; CSF; CSF2; CSF-2; GMCSF; GM-CSF; GMCSF; granulocyte-macrophage colony-stimulating factor; granulocyte-macrophage colony stimulating factor; MGC131935; MGC138897; Molgramosti |
Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥98%(SDS-PAGE&HPLC) |
Purity | >98% (SDS-PAGE, HPLC) |
Biological Activity | Measured in a cell proliferation assay using murine FDC-P1 cells. The ED50 for this effect is typically <0.01ng/mL. |
Species | Rat |
Amino Acids | 18 to 144 |
Sequence | APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSI QRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCE IEVTTFEDFIKNLKGFLFDIPFDCWKPVQK |
Protein Tag | No tag |
Protein Length | Full length protein |
Accession # | P48750 |
Source | Recombinant |
Predicted molecular weight | 14.5 kDa |
SDS-PAGE | 13.7 kDa, under reducing conditions; 13.7 kDa, under non-reducing conditions. |
Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance |
Recombinant Rat GM-CSF Protein (rp155067)-Protein Bioactivity
Measured in a cell proliferation assay using FDC-P1 cells. The ED₅₀ for this effect is typically <0.01ng/mL.
Recombinant Rat GM-CSF Protein (rp155067)-SDS-PAGE
3μg/lane of Recombinant Rat GM-CSF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 13.7 kDa.
Form | Lyophilized |
---|---|
Reconstitution | 1.This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in a sterile aqueous buffer to an appropriate concentration. Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. F |
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Dry ice |
Stability And Storage | Upon delivery aliquot, Store at -20°C, Avoid freeze / thaw cycles. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
Lot Number | Certificate Type | Date | Item |
---|---|---|---|
ZJ23F0600299 | Certificate of Analysis | Jun 09, 2023 | rp155067 |
ZJ23F0600298 | Certificate of Analysis | Jun 09, 2023 | rp155067 |