| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp155067-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $89.90 | |
| rp155067-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $249.90 | |
| rp155067-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,779.90 |
Animal Free, ＞98% (SDS-PAGE, HPLC), Active, E. coli, No tag, 18-144 aa
| Product Name | Recombinant Rat GM-CSF Protein, ＞98% (SDS-PAGE, HPLC), high purity |
|---|---|
| Synonyms | Colony stimulating factor 2 (granulocyte-macrophage); Colony-stimulating factor; CSF; CSF2; CSF-2; GMCSF; GM-CSF; GMCSF; granulocyte-macrophage colony-stimulating factor; granulocyte-macrophage colony stimulating factor; MGC131935; MGC138897; Molgramosti |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance |
| Product Description | Purity >98% SDS-PAGE. > 98 % by HPLC. Additional sequence information This product is for the mature full length protein. The signal peptide is not included. Function Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. Background GM-CSF is a hematopoietic growth factor that stimulates the development of neutrophils and macrophages, and promotes the proliferation and development of early erythroid megakaryocytic and eosinophilic progenitor cells. It is produced by endothelial cells, monocytes, fibroblasts and T-lymphocytes. GM-CSF inhibits neutrophil migration and enhances the functional activity of the mature end-cells. GM-CSF has also been reported to have a functional role on non-hematopoietic cells and can induce human endothelial cells to migrate and proliferate. Additionally, it can stimulate the proliferation of a number of tumor cell lines, including osteogenic sarcoma, carcinoma and adenocarcinoma cell lines. It is reported that GM-CSF has no biological effects across species. Recombinant Rat GM-CSF is a 14.5kDa globular protein consisting of 127 amino acid residues. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥98%(SDS-PAGE&HPLC) |
| Purity | ＞98% (SDS-PAGE, HPLC) |
| Bioactivity | Measured in a cell proliferation assay using murine FDC-P1 cells. The ED50 for this effect is typically <0.01ng/mL. |
| Endotoxin Concentration | ＜0.01 EU/μg |
| Expression System | E.coli |
| Species | Rat |
| Amino Acids | 18-144 aa |
| Sequence | APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSI QRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCE IEVTTFEDFIKNLKGFLFDIPFDCWKPVQK |
| Protein Tag | No tag |
| Protein Length | Full length protein |
| Accession # | P48750 |
| Source | Recombinant |
| Predicted molecular weight | 14.5 kDa |
| SDS-PAGE | 13.7 kDa, under reducing conditions; 13.7 kDa, under non-reducing conditions. |
Recombinant Rat GM-CSF Protein (rp155067)-Protein Bioactivity
Measured in a cell proliferation assay using FDC-P1 cells. The ED₅₀ for this effect is typically <0.01ng/mL.
Recombinant Rat GM-CSF Protein (rp155067)-SDS-PAGE
3μg/lane of Recombinant Rat GM-CSF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 13.7 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | 1.This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in a sterile aqueous buffer to an appropriate concentration. Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. F |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Upon delivery aliquot, Store at -20°C, Avoid freeze / thaw cycles. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0600299 | Certificate of Analysis | Jun 09, 2023 | rp155067 |
| ZJ23F0600298 | Certificate of Analysis | Jun 09, 2023 | rp155067 |
