| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp155124-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $199.90 | |
| rp155124-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $699.90 | |
| rp155124-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $1,269.90 | |
| rp155124-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,449.90 |
Animal free, >96% (SDS-PAGE, HPLC), Active, E. coli, No tag, 25-211 aa
| Product Name | Recombinant Rat IL-6 Protein, ＞96% (SDS-PAGE, HPLC), high purity |
|---|---|
| Synonyms | B-cell differentiation factor; B-cell stimulatory factor 2; BSF2; BSF-2; CDF; CTL differentiation factor; hybridoma growth factor; MGI-2A ; Interleukin BSF 2; Cytotoxic T cell differentiation factor; Hepatocyte stimulating factor; Hepatocyte stimulatory |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, 高性能 |
| Product Description | Interleukin-6 (IL-6) is encoded by the IL-6 gene and acts as both a pro-inflammatory and anti-inflammatory cytokine. IL-6 is a pleiotropic cytokine that plays an important role in host defense by regulating immune and inflammatory responses. Produced by T cells, monocytes, fibroblasts, endothelial cells and keratinocytes, IL-6 has diverse biological functions. It stimulates B cell differentiation and antibody production, synergizes with IL-3 in megakaryocyte development and platelet production, induces expression of hepatic acute-phase proteins, and regulates bone metabolism. IL-6 signals through the IL-6 receptor system that consists of two chains, IL-6R α and gp130. Murine IL-6 is inactive on human cells, while both human and murine are equally active on murine cells. Recombinant Rat IL-6 is a 21.7kDa protein containing 187 amino acid residues. Purity >96% SDS-PAGE Function Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥96%(SDS-PAGE&HPLC) |
| Purity | ＞96% (SDS-PAGE, HPLC) |
| Bioactivity | 1. Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine 7TD1 cells is less than 0.01 ng/mL, corresponding to a specific activity of >1.0 ×108 IU/mg. 2. Measured in a cell pro |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | E.coli |
| Species | Rat |
| Amino Acids | 25-211 aa |
| Sequence | FPTSQVRRGDFTEDTTHNRPVYTTSQVGGLITYVLREILEMRKELCNGN SDCMNSDDALSENNLKLPEIQRNDGCFQTGYNQEICLLKICSGLLEFRFY LEFVKNNLQDNKKDKARVIQSNTETLVHIFKQEIKDSYKIVLPTPTSNAL LMEKLESQKEWLRTKTIQLILKALEEFLKVTMRSTRQT |
| Protein Tag | No tag |
| Accession # | P20607 |
| Predicted molecular weight | 21.7 kDa |
| SDS-PAGE | 20.9 kDa, under reducing conditions; 19.1 kDa, under non-reducing conditions. |
Recombinant Rat IL-6 Protein (rp155124) - Protein Bioactivity
Fully biologically active when compared to standard. The ED₅₀ as determined by a cell proliferation assay using IL-6-dependent murine 7TD1 cells is less than 0.01 ng/mL, corresponding to a specific activity of >1.0 ×10⁸ IU/mg.
Recombinant Rat IL-6 Protein (rp155124) - Protein Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is less than 10 ng/mL.
Recombinant Rat IL-6 Protein (rp155124)- SDS-PAGE
2.5 μg/lane of Recombinant Rat IL-6 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 20.9 kDa under reducing conditions and 19.1 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in a sterile aqueous buffer to an appropriate concentration. Stock solutions should be apportioned into working aliquots and stored at ≤-20℃. Further |
| Storage Temp | Store at -80°C |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0901077 | Certificate of Analysis | Sep 18, 2023 | rp155124 |
| ZJ23F0901076 | Certificate of Analysis | Sep 18, 2023 | rp155124 |
| ZJ23F0901075 | Certificate of Analysis | Sep 18, 2023 | rp155124 |
