| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp155217-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $139.90 | |
| rp155217-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $439.90 | |
| rp155217-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $789.90 | |
| rp155217-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Animal Free, >95% (SDS-PAGE), Active, E.coli, His-tag, 26-189 aa
| Product Name | Recombinant Rat SCF Protein, ＞95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | c-kit Ligand; DCUA; DFNA69; DKFZp686F2250; familial progressive hyperpigmentation 2; FPH2; FPHH; KIT ligand; Kitl; KITLG; KL-1; Mast cell growth factor; MGF; MGFSHEP7; SCF; SCFStem cell factor; SFc-Kit ligand; SHEP7; SLF; steel factor; C kit ligand; C-kit |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance |
| Product Description | Purity >95% SDS-PAGE. Additional sequence information A single non-glycosylated polypeptide chain. Function Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins. Post-translational A soluble form (sKITLG) is produced by proteolytic processing of isoform 1 in the extracellular domain. Found in two differentially glycosylated forms, LMW-SCF and HMW-SCF. LMW-SCF is fully N-glycosylated at Asn-145, partially N-glycosylated at Asn-90, O-glycosylated at Ser-167, Thr-168 and Thr-180, and not glycosylated at Asn-97 or Asn-118. HMW-SCF is N-glycosylated at Asn-118, Asn-90 and Asn-145, O-glycosylated at Ser-167, Thr-168 and Thr-180, and not glycosylated at Asn-97. A soluble form exists as a cleavage product of the extracellular domain. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ＞95% (SDS-PAGE) |
| Bioactivity | Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is typically less than 15.72 ng/mL. |
| Endotoxin Concentration | < 1 EU/μg |
| Expression System | E. coli |
| Species | Rat |
| Amino Acids | 26-189 aa |
| Sequence | QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAHHHHHH |
| Protein Tag | C-His |
| Accession # | P21581 |
| Predicted molecular weight | 18 kDa |
| SDS-PAGE | 17.2 kDa, under reducing conditions; 15.0 kDa, under non-reducing conditions. |
Recombinant Rat SCF Protein (rp155217) - Protein Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is typically less than 15.72 ng/mL.
Recombinant Rat SCF Protein (rp155217) - SDS-PAGE
2.5 μg/lane of Recombinant Rat SCF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 17.2 kDa under reducing conditions and 15.0 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Storage Temp | Store at -80°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0800872 | Certificate of Analysis | Aug 23, 2023 | rp155217 |
| ZJ23F0800873 | Certificate of Analysis | Aug 23, 2023 | rp155217 |
| ZJ23F0800874 | Certificate of Analysis | Aug 23, 2023 | rp155217 |
