Recombinant Sumo Protease Protein

Features and benefits

Expression System: E. coli
Protein Tag: N-His
Bioactivity: ≥ 200 Units/μg; Measured by its ability to be proteolytically processed by substrate protein, one unit of SUMO Protease is defined as the amount of enzyme needed to cleave 85% of 2µg of substrate protein at 30°C in one hour.
Endotoxin Concentration: ＜1.0 EU/μg

Item Number

rp176272

Grouped product items
SKU	Size	Availability	Price
rp176272-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free!	10μg	In stock	$139.90
rp176272-100μg	100μg	In stock	$499.90
rp176272-1mg	1mg	In stock	$3,999.90

Carrier Free, >90% SDS-PAGE, Active, E.coli, His tag, 403-621 aa

View related series

Basic Description

Product Name	Recombinant Sumo Protease Protein
Synonyms	Ubiquitin-like-specific protease 1; ULP1; SUMO protease ULP1
Grade	ActiBioPure™, Azide Free, Bioactive, Carrier Free, High Performance
Product Description	Purity:>90%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description： Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SMT3 to its mature form and deconjugation of SMT3 from targeted proteins. Has an essential role in the G2/M phase of the cell cycle. Probable centromere protein from the fission yeast (Schizosaccharomyces pombe). Similar to yeast Smt3p-specific protease, degrades conjugated ubiquitin-like protein [S. pombe].
Specifications & Purity	Carrier Free, Azide Free, Bioactive, ActiBioPure™, High performance, ≥90%(SDS-PAGE)
Bioactivity	≥ 200 Units/μg; Measured by its ability to be proteolytically processed by substrate protein, one unit of SUMO Protease is defined as the amount of enzyme needed to cleave 85% of 2µg of substrate protein at 30°C in one hour.
Endotoxin Concentration	＜1.0 EU/μg
Expression System	E. coli
Amino Acids	403-621 aa
Sequence	MHHHHHHLVPELNEKDDDQVQKALASRENTQLMNRDNIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDCGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK
Protein Tag	N-His
Predicted molecular weight	26.4 kDa
SDS-PAGE	25.8kDa, reducing conditions; 25.8 kDa, non-reducing condition

Product Specifications

Form	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C stable up to 1 year. Avoid freeze/thaw cycle.

Certificates

Enter Lot Number to search for COA:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot Number	Certificate Type	Date	Item
ZJ23F1201958	Certificate of Analysis	Dec 13, 2023	rp176272
ZJ23F1201957	Certificate of Analysis	Dec 13, 2023	rp176272
ZJ23F1201956	Certificate of Analysis	Dec 13, 2023	rp176272
ZJ23R1200171	Certificate of Analysis	Dec 05, 2023	rp176272

Solution Calculators

Determine the necessary mass, volume, or concentration for preparing a solution.

Determine the dilution needed to prepare a stock solution.

Basic Description