Determine the necessary mass, volume, or concentration for preparing a solution.
Recombinant Taq DNA Polymerase Protein (A156186) - PCR
|
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
A156186-1000U | 1000U | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $79.90 |
Product Name | Recombinant Taq DNA Polymerase Proteinused for PCR various applications, CAS No.9012-90-2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Synonyms | DNA polymerase I; thermostable; DNA-directed DNA polymerase | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Grade | EnzymoPure™ | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Product Description | Purity: >95%, by SDS-PAGE visualized with Coomassie® Blue Staining. Taq DNA Polymerase is a thermostable enzyme that synthesizes DNA from single-stranded templates in the presence of dNTPs and a primer. The enzyme consists of a single polypeptide with a molecular weight of 94 kDa. It has a 5´→3´ DNA polymerase activity and a 5´→3´ exonuclease activity. Source: Unit definition One unit of Taq DNA Polymerase is the amount of enzyme required to incorporate 10 nmoles of deoxyribonucleotide into DNA in 30 min at 74°C. Product content: 1. Taq DNA Polymerase ( 5 U/μL ) 2. 10×Taq Buffer(Mg2+Plus):200mM Tris-HCl,500mM KCl,20mM MgCl2,1mM DTT,pH9.3 PCR Reaction Setup:
Incubate reactions in a thermal cycler:
Optimization Strategies: Different PCR reaction conditions, including temperature, time and number of cycles, should be set according to different template, primer, length of PCR product and GC content. The time setting of STEP4(extension) should be set according to the length of PCR products, usually the extension time of each kb product is 1min. For initial PCR, the number of cycles can be set to 35 to ensure that the expected PCR product can be amplified as much as possible. The number of PCR reaction cycles that need to be semi-quantitative or quantitative must be properly optimized so that the PCR reaction does not reach a plateau. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Specifications & Purity | ≥95%, Lot by Lot | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Bioactivity | Taq DNA polymerase is a heat-resistant enzyme that synthesizes DNA from a single-stranded template in the presence of dNTP and primers, with 5´→3´ DNA polymerase activity and 5´→3´ exonuclease activity. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Expression System | E. coli | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Species | Thermus aquaticus | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino Acids | 1-832 aa | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequence | MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSDRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVRTDLPLE | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Tag | N-His | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Length | Protein fragments | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Source | Recombinant | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Predicted molecular weight | 96 kDa | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
SDS-PAGE | 96 kDa |
Recombinant Taq DNA Polymerase Protein (A156186) - PCR
|
Application | PCR |
---|---|
Form | Liquid |
Concentration | Lot by Lot |
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at -20°C stable for 1 year. Avoid freeze / thaw cycle. |
CAS | 9012-90-2 |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
Lot Number | Certificate Type | Date | Item |
---|---|---|---|
ZJ23F0800921 | Certificate of Analysis | Aug 25, 2023 | A156186 |
Pictogram(s) | GHS07 |
---|---|
Signal | Warning |
Hazard Statements | H315:Causes skin irritation H319:Causes serious eye irritation H335:May cause respiratory irritation |
Precautionary Statements | P305+P351+P338:IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses if present and easy to do - continue rinsing. P302:IF ON SKIN: P352:Wash with plenty of water/... |
WGK Germany | WGK1 |
RIDADR | NONH for all modes of transport |