| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| np156148-0.1ml | 0.1ml | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $79.90 | |
| np156148-1ml | 1ml | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $599.90 |
Streptavidin was conjugated with enzyme under optimum conditions, and unconjugated Streptavidin and free enzyme were removed.
| Product Name | SA-HRPused for WB, Dot, ELISA, ICC, IHC-Fr, IHC-P various applications |
|---|---|
| Synonyms | SA-HRP (HRP-labeled Streptavidin); Streptavidin-Horseradish Peroxidase; SAv-HRP; SA V1; SA V2; streptavidin; Streptavidin V1; Streptavidin V2 |
| Grade | Azide Free, High performance |
| Product Description | Background Streptavidin is a non-glycosylated protein from the bacterium Streptomyces avidinii. Streptavidin homotetramers have a particularly high, non-covalent binding affinity for biotin. When conjugated with an enzyme (eg, Horseradish Peroxidase or Alkaline Phosphatase) and coupled with a colorimetric or luminescent substrate development system, streptavidin has found widespread use along with biotinylated antibodies in a number of applications including Western blot, ELISA, ELISPOT, immunocytochemistry and immunohistochemistry. Recommended Usage： WB: 1:10000 -1:100000 ELISA: 1:1000-1:10000 Avoid using biotin-containing solutions as diluents and solutions containing sodium azide. Sodium azide is an inhibitor of horseradish peroxidase. It is recommended that the reagent be titrated for optimal performance for each application. |
| Specifications & Purity | Azide Free, High performance, Streptavidin was conjugated with enzyme under optimum conditions, and unconjugated Streptavidin and free enzyme were removed. |
| Species | Streptomyces avidinii |
| Sequence | MRKIVVAAIAVSLTTVSITASASADPSKDSKAQVSAAEAGITGTWYNQLG STFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWT VAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVG HDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ |
| Protein Length | Full length protein |
| Conjugation | HRP |
| Source | Native |
WB-Streptavidin (HRP) (np156148)
Various whole cell lysates were subjected to SDS PAGE followed by western blot with Streptavidin (HRP) (np156148) at dilution of 1:10000 incubated at room temperature for 1 hour. Biotin-γ-actin antibody as primary antibody. Developed using the ECL technique. Observed band size was 42kDa. Exposure time was 10s.
ELISA-Streptavidin (HRP) (np156148)
ELISA results of Streptavidin (HRP) (np156148) tested against Biotin-BSA. Each well was coated in duplicate with 1 ng of Biotin-BSA.
WB-Streptavidin (HRP) (np156148)
HT-29 whole cell lysate was subjected to SDS PAGE followed by western blot with Streptavidin (HRP) (np156148) at dilution of 1:5000 incubated at room temperature for 1 hour. Biotin-γ-actin antibody as primary antibody. Developed using the ECL technique. Observed band size was 42kDa. Exposure time was 8s.
| Application | WB, Dot, ELISA, ICC, IHC-Fr, IHC-P |
|---|---|
| Form | Liquid |
| Concentration | Streptavidin was conjugated with enzyme under optimum conditions, and unconjugated Streptavidin and free enzyme were removed. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle and protected from prolonged exposure to light. Prepare working dilution on day of use. |
| Application | Dilution info |
|---|---|
| WB | 1:10000-1:100000 |
| ELISA |
1/1000-1/10000
|
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0708372 | Certificate of Analysis | Jul 16, 2024 | np156148 |
| ZJ24F0708371 | Certificate of Analysis | Jul 16, 2024 | np156148 |
| ZJ24R0500601 | Certificate of Analysis | May 25, 2024 | np156148 |
| ZJ23F0300087 | Certificate of Analysis | Jan 25, 2024 | np156148 |
| ZJ23F0300088 | Certificate of Analysis | Jan 25, 2024 | np156148 |
