The store will not work correctly when cookies are disabled.
PIN4
| Description | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 |
|---|
Gene and Protein Information
| Gene ID | 5303 |
|---|
| Uniprot Accession IDs | A8E0G6 B3KXM0 F5H1P5 Q0D2H3 Q3MHV0 Q52M21 Q5HYW6 Q6IRW4 |
|---|
| Ensembl ID | ENSP00000362773 |
|---|
| Symbol | EPVH PAR14 PAR17 |
|---|
| Family | Belongs to the PpiC/parvulin rotamase family. PIN4 subfamily. |
|---|
| Sequence | MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 699273 | PIN4 | peptidylprolyl cis/trans isomerase, NIMA-interacting 4 | 9544 | | OMA, EggNOG |
| Mouse | 69713 | Pin4 | protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin) | 10090 | MGI:1916963 | Inparanoid, OMA, EggNOG |
| Rat | 684441 | Pin4 | peptidylprolyl cis/trans isomerase, NIMA-interacting 4 | 10116 | RGD:1590326 | OMA, EggNOG |
| Dog | 100687619 | LOC100687619 | peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 | 9615 | | Inparanoid, OMA, EggNOG |
| Cow | 100126055 | PIN4 | peptidylprolyl cis/trans isomerase, NIMA-interacting 4 | 9913 | VGNC:32903 | Inparanoid, OMA, EggNOG |
| Pig | 100524473 | PIN4 | peptidylprolyl cis/trans isomerase, NIMA-interacting 4 | 9823 | | OMA, EggNOG |
| Opossum | 100020028 | PIN4 | peptidylprolyl cis/trans isomerase, NIMA-interacting 4 | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 422134 | PIN4 | peptidylprolyl cis/trans isomerase, NIMA-interacting 4 | 9031 | CGNC:2839 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100565280 | pin4 | peptidylprolyl cis/trans isomerase, NIMA-interacting 4 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 394809 | pin4 | peptidylprolyl cis/trans isomerase, NIMA-interacting 4 | 8364 | XB-GENE-1004487 | Inparanoid, OMA, EggNOG |
| Zebrafish | 553574 | pin4 | protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin) | 7955 | ZDB-GENE-050522-117 | Inparanoid, OMA, EggNOG |
| C. elegans | 174979 | pinn-4 | Peptidyl-prolyl cis-trans isomerase | 6239 | | Inparanoid, OMA, EggNOG |
| Fruitfly | 43044 | CG11858 | CG11858 gene product from transcript CG11858-RA | 7227 | FBgn0039305 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
