The store will not work correctly when cookies are disabled.
Protein or Target Summary
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4
| Gene ID | 5303 |
|---|
| uniprot | Q9Y237 |
|---|
| Gene Name | PIN4 |
|---|
| Ensernbl ID | ENSP00000362773 |
|---|
| Family | Belongs to the PpiC/parvulin rotamase family. PIN4 subfamily. |
|---|
| Sequence | MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5303 | PIN4 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 | Q9Y237 |
| MOUSE | 69713 | Pin4 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 | Q9CWW6 |
| RAT | 684441 | Pin4 | Peptidyl-prolyl cis-trans isomerase | M0RCP9 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
