The store will not work correctly when cookies are disabled.
Protein or Target Summary
Peptidyl-prolyl cis-trans isomerase F, mitochondrial
| Gene ID | 10105 |
|---|
| uniprot | P30405 |
|---|
| Gene Name | PPIF |
|---|
| Ensernbl ID | ENSP00000225174 |
|---|
| Family | Belongs to the cyclophilin-type PPIase family. |
|---|
| Sequence | MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 10105 | PPIF | Peptidyl-prolyl cis-trans isomerase F, mitochondrial | P30405 |
| MOUSE | 105675 | Ppif | Peptidyl-prolyl cis-trans isomerase F, mitochondrial | Q99KR7 |
| RAT | 282819 | Ppif | Peptidyl-prolyl cis-trans isomerase F, mitochondrial | P29117 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
