| Description | Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 1854 |
|---|---|
| Uniprot Accession IDs | A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 dUTPase |
| Ensembl ID | ENSP00000370376 |
| Symbol | dUTPase |
| Family | Belongs to the dUTPase family. |
| Sequence | MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Horse | 100070214 | DUT | deoxyuridine triphosphatase | 9796 | VGNC:17360 | OMA, EggNOG |
| S.cerevisiae | 852554 | DUT1 | bifunctional dITP/dUTP diphosphatase | 4932 | S000000456 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / hydrolase / Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
protein / phosphatase / Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
protein / hydrolase / Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
protein / phosphatase / Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
DTO Classes
protein / Enzyme / Hydrolase / Phosphatase / Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
protein / Enzyme / Hydrolase / Phosphatase / Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|