DUT

Description	Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial

Gene and Protein Information

Gene ID	1854
Uniprot Accession IDs	A8K650 B4DPR5 O14785 Q16708 Q16860 Q6FHN1 Q6NSA3 Q96Q81 dUTPase
Ensembl ID	ENSP00000370376
Symbol	dUTPase
Family	Belongs to the dUTPase family.
Sequence	MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Horse	100070214	DUT	deoxyuridine triphosphatase	9796	VGNC:17360	OMA, EggNOG
S.cerevisiae	852554	DUT1	bifunctional dITP/dUTP diphosphatase	4932	S000000456	OMA, EggNOG

Protein Classes

PANTHER Classes
protein / hydrolase / Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
protein / phosphatase / Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial

DTO Classes
protein / Enzyme / Hydrolase / Phosphatase / Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

DUT