Protein or Target Summary
Presenilins-associated rhomboid-like protein, mitochondrial
| Gene ID | 55486 |
|---|---|
| uniprot | Q9H300 |
| Gene Name | PARL |
| Ensernbl ID | ENSP00000325421 |
| Family | Belongs to the peptidase S54 family. |
| Sequence | MAWRGWAQRGWGCGQAWGASVGGRSCEELTAVLTPPQLLGRRFNFFIQQKCGFRKAPRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQRTVTGIIAANVLVFCLWRVPSLQRTMIRYFTSNPASKVLCSPMLLSTFSHFSLFHMAANMYVLWSFSSSIVNILGQEQFMAVYLSAGVISNFVSYVGKVATGRYGPSLGASGAIMTVLAAVCTKIPEGRLAIIFLPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYVTYGHELIWKNREPLVKIWHEIRTNGPKKGGGSK Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 55486 | PARL | Presenilins-associated rhomboid-like protein, mitochondrial | Q9H300 |
| MOUSE | Parl | Presenilins-associated rhomboid-like protein, mitochondrial | D6RCZ6 | |
| MOUSE | Parl | Presenilins-associated rhomboid-like protein, mitochondrial | A0A338P6U4 | |
| MOUSE | Parl | Presenilins-associated rhomboid-like protein, mitochondrial | A0A338P7G5 | |
| MOUSE | Parl | Presenilins-associated rhomboid-like protein, mitochondrial | D6RJ50 | |
| MOUSE | Parl | Presenilins-associated rhomboid-like protein, mitochondrial | A0A338P759 | |
| MOUSE | Parl | Presenilins-associated rhomboid-like protein, mitochondrial | A0A338P6A0 | |
| MOUSE | 381038 | Parl | Presenilins-associated rhomboid-like protein, mitochondrial | Q5XJY4 |
| RAT | 287979 | Parl | Presenilin associated, rhomboid-like | B0BMU4 |
| RAT | Parl | Presenilins-associated rhomboid-like protein, mitochondrial | M0R589 | |
| RAT | Parl | Presenilins-associated rhomboid-like protein, mitochondrial | F1LPN4 | |
| RAT | 287979 | Parl | Presenilins-associated rhomboid-like protein, mitochondrial | Q3B8P0 |
Protein Classes
PANTHER Classes
protein / serine protease / Presenilins-associated rhomboid-like protein, mitochondrial
protein / protease / Presenilins-associated rhomboid-like protein, mitochondrial
protein / hydrolase / Presenilins-associated rhomboid-like protein, mitochondrial
protein / serine protease / Presenilins-associated rhomboid-like protein, mitochondrial
protein / protease / Presenilins-associated rhomboid-like protein, mitochondrial
protein / hydrolase / Presenilins-associated rhomboid-like protein, mitochondrial
DTO Classes
protein / Enzyme / Protease / Serine protease / Presenilins-associated rhomboid-like protein, mitochondrial
protein / Enzyme / Protease / Serine protease / Presenilins-associated rhomboid-like protein, mitochondrial
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx