PARL
| Description | Presenilins-associated rhomboid-like protein, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 55486 |
|---|---|
| Uniprot Accession IDs | Q96CQ4 Q9BTJ6 Q9P1E3 |
| Ensembl ID | ENSP00000325421 |
| Symbol | PSARL PSARL PSARL1 RHBDS1 PRO2207 PSENIP2 |
| Family | Belongs to the peptidase S54 family. |
| Sequence | MAWRGWAQRGWGCGQAWGASVGGRSCEELTAVLTPPQLLGRRFNFFIQQKCGFRKAPRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQRTVTGIIAANVLVFCLWRVPSLQRTMIRYFTSNPASKVLCSPMLLSTFSHFSLFHMAANMYVLWSFSSSIVNILGQEQFMAVYLSAGVISNFVSYVGKVATGRYGPSLGASGAIMTVLAAVCTKIPEGRLAIIFLPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYVTYGHELIWKNREPLVKIWHEIRTNGPKKGGGSK Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 460877 | PARL | presenilin associated rhomboid like | 9598 | VGNC:9696 | OMA, EggNOG |
| Macaque | 704652 | PARL | presenilin associated rhomboid like | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 381038 | Parl | presenilin associated, rhomboid-like | 10090 | MGI:1277152 | Inparanoid, OMA, EggNOG |
| Rat | 287979 | Parl | presenilin associated, rhomboid-like | 10116 | RGD:1306191 | Inparanoid, OMA |
| Dog | 488100 | PARL | presenilin associated rhomboid like | 9615 | VGNC:54107 | Inparanoid, OMA, EggNOG |
| Horse | 100058851 | PARL | presenilin associated rhomboid like | 9796 | Inparanoid, OMA, EggNOG | |
| Cow | 514191 | PARL | presenilin associated rhomboid like | 9913 | VGNC:53595 | Inparanoid, OMA, EggNOG |
| Opossum | 100027636 | PARL | presenilin associated rhomboid like | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 424767 | PARL | presenilin associated rhomboid like | 9031 | CGNC:1651 | Inparanoid, EggNOG |
| Anole lizard | 100553171 | parl | presenilin associated rhomboid like | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 792889 | parl | presenilin associated rhomboid like | 7955 | OMA, EggNOG | |
| C. elegans | 190260 | rom-5 | Rhomboid-like protein | 6239 | Inparanoid, EggNOG | |
| Fruitfly | 36281 | rho-7 | rhomboid-7 | 7227 | FBgn0033672 | Inparanoid, EggNOG |
| S.cerevisiae | 852993 | PCP1 | rhomboid protease PCP1 | 4932 | S000003333 | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes
protein / serine protease / Presenilins-associated rhomboid-like protein, mitochondrial
protein / protease / Presenilins-associated rhomboid-like protein, mitochondrial
protein / hydrolase / Presenilins-associated rhomboid-like protein, mitochondrial
protein / serine protease / Presenilins-associated rhomboid-like protein, mitochondrial
protein / protease / Presenilins-associated rhomboid-like protein, mitochondrial
protein / hydrolase / Presenilins-associated rhomboid-like protein, mitochondrial
DTO Classes
protein / Enzyme / Protease / Serine protease / Presenilins-associated rhomboid-like protein, mitochondrial
protein / Enzyme / Protease / Serine protease / Presenilins-associated rhomboid-like protein, mitochondrial
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|