The store will not work correctly when cookies are disabled.
PIN1
| Description | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 |
|---|
Gene and Protein Information
| Gene ID | 5300 |
|---|
| Uniprot Accession IDs | A8K4V9 Q53X75 |
|---|
| Ensembl ID | ENSP00000247970 |
|---|
| Symbol | DOD UBL5 |
|---|
| Sequence | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 745021 | PIN1 | peptidylprolyl cis/trans isomerase, NIMA-interacting 1 | 9598 | | OMA, EggNOG |
| Macaque | 711095 | PIN1 | peptidylprolyl cis/trans isomerase, NIMA-interacting 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 23988 | Pin1 | protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1 | 10090 | MGI:1346036 | Inparanoid, OMA, EggNOG |
| Rat | 298696 | Pin1 | peptidylprolyl cis/trans isomerase, NIMA-interacting 1 | 10116 | RGD:1310299 | OMA, EggNOG |
| Dog | 484963 | PIN1 | peptidylprolyl cis/trans isomerase, NIMA-interacting 1 | 9615 | | Inparanoid, OMA, EggNOG |
| Horse | | PIN1 | peptidylprolyl cis/trans isomerase, NIMA-interacting 1 [Source:HGNC Symbol;Acc:HGNC:8988] | 9796 | | OMA, EggNOG |
| Cow | 535470 | PIN1 | peptidylprolyl cis/trans isomerase, NIMA-interacting 1 | 9913 | | Inparanoid, OMA, EggNOG |
| Pig | 100512827 | PIN1 | peptidylprolyl cis/trans isomerase, NIMA-interacting 1 | 9823 | | Inparanoid, EggNOG |
| Opossum | | PIN1 | peptidylprolyl cis/trans isomerase, NIMA-interacting 1 [Source:HGNC Symbol;Acc:HGNC:8988] | 13616 | | Inparanoid, OMA, EggNOG |
| Xenopus | 493472 | pin1 | peptidylprolyl cis/trans isomerase, NIMA-interacting 1 | 8364 | XB-GENE-856254 | Inparanoid, OMA, EggNOG |
| Zebrafish | 393721 | pin1 | peptidylprolyl cis/trans isomerase, NIMA-interacting 1 | 7955 | ZDB-GENE-040426-1714 | Inparanoid, OMA |
| C. elegans | 190941 | pinn-1 | Peptidyl-prolyl cis-trans isomerase | 6239 | | Inparanoid, OMA, EggNOG |
| Fruitfly | 33111 | dod | dodo | 7227 | FBgn0015379 | Inparanoid, OMA, EggNOG |
| S.cerevisiae | 853475 | ESS1 | peptidylprolyl isomerase ESS1 | 4932 | S000003778 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
