The store will not work correctly when cookies are disabled.
Protein or Target Summary
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
| Gene ID | 5300 |
|---|
| uniprot | Q13526 |
|---|
| Gene Name | PIN1 |
|---|
| Ensernbl ID | ENSP00000247970 |
|---|
| Sequence | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5300 | PIN1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 | Q13526 |
| MOUSE | | Pin1 | Peptidyl-prolyl cis-trans isomerase | Q3UTI7 |
| MOUSE | 23988 | Pin1 | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 | Q9QUR7 |
| RAT | 298696 | Pin1 | Peptidyl-prolyl cis-trans isomerase | B0BNL2 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
