JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
PHPT1

PHPT1

Description	14 kDa phosphohistidine phosphatase

Gene and Protein Information

Gene ID	29085
Uniprot Accession IDs	B1AMX0 B1AMX1 Q9H0Y3
Ensembl ID	ENSP00000247665
Symbol	PHP14 PHP PHP14 CGI-202 HSPC141 HEL-S-132P
Family	Belongs to the janus family.
Sequence	MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Mouse	75454	Phpt1	phosphohistidine phosphatase 1	10090	MGI:1922704	Inparanoid, OMA, EggNOG
Rat	296571	Phpt1	phosphohistidine phosphatase 1	10116	RGD:1311355	Inparanoid, OMA, EggNOG
Dog	491245	PHPT1	phosphohistidine phosphatase 1	9615	VGNC:44509	Inparanoid, OMA, EggNOG
Cow	618691	PHPT1	phosphohistidine phosphatase 1	9913	VGNC:32846	Inparanoid, OMA, EggNOG
Opossum	100017116	PHPT1	phosphohistidine phosphatase 1	13616		Inparanoid, EggNOG
Anole lizard	100558315	phpt1	phosphohistidine phosphatase 1	28377		Inparanoid, OMA, EggNOG
Xenopus	100497662	phpt1	phosphohistidine phosphatase 1	8364	XB-GENE-979475	Inparanoid, OMA, EggNOG
Zebrafish	445172	phpt1	phosphohistidine phosphatase 1	7955	ZDB-GENE-040801-85	Inparanoid, OMA
C. elegans	185336	phip-1	Protein HIstidine Phosphatase	6239		Inparanoid, OMA
Fruitfly	43569	janA	janus A	7227	FBgn0001280	Inparanoid, EggNOG

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]