The store will not work correctly when cookies are disabled.
Protein or Target Summary
14 kDa phosphohistidine phosphatase
| Gene ID | 29085 |
|---|
| uniprot | Q9NRX4 |
|---|
| Gene Name | PHPT1 |
|---|
| Ensernbl ID | ENSP00000247665 |
|---|
| Family | Belongs to the janus family. |
|---|
| Sequence | MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 29085 | PHPT1 | 14 kDa phosphohistidine phosphatase | Q9NRX4 |
| MOUSE | 75454 | Phpt1 | 14 kDa phosphohistidine phosphatase | Q9DAK9 |
| RAT | 296571 | Phpt1 | Phosphohistidine phosphatase 1 | D3ZP47 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
