The store will not work correctly when cookies are disabled.
Protein or Target Summary
Eukaryotic translation initiation factor 1
| Gene ID | 10209 |
|---|
| uniprot | P41567 |
|---|
| Gene Name | EIF1 |
|---|
| Ensernbl ID | ENSP00000419449 |
|---|
| Family | Belongs to the SUI1 family. |
|---|
| Sequence | MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 10209 | EIF1 | Eukaryotic translation initiation factor 1 | P41567 |
| MOUSE | 20918 | Eif1 | Eukaryotic translation initiation factor 1 | P48024 |
| MOUSE | | Eif1 | Eukaryotic translation initiation factor 1 | J3QPZ8 |
| MOUSE | | Eif1 | Uncharacterized protein | Q3UBT8 |
| MOUSE | | Eif1 | Eukaryotic translation initiation factor 1 | J3QN87 |
| MOUSE | 20918 | Eif1 | Eukaryotic translation initiation factor 1 | Q4V9T8 |
| RAT | 287703 | Eif1 | Eukaryotic translation initiation factor 1 | B0K008 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
