The store will not work correctly when cookies are disabled.
RBP4
| Description | Retinol-binding protein 4 |
|---|
Gene and Protein Information
| Gene ID | 5950 |
|---|
| Uniprot Accession IDs | D3DR38 O43478 O43479 Q5VY24 Q8WWA3 Q9P178 |
|---|
| Ensembl ID | ENSP00000360522 |
|---|
| Symbol | RDCCAS MCOPCB10 |
|---|
| Family | Belongs to the calycin superfamily. Lipocalin family. |
|---|
| Sequence | MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 450617 | RBP4 | retinol binding protein 4 | 9598 | VGNC:5717 | Inparanoid, OMA, EggNOG |
| Mouse | 19662 | Rbp4 | retinol binding protein 4, plasma | 10090 | MGI:97879 | Inparanoid, OMA, EggNOG |
| Rat | 25703 | Rbp4 | retinol binding protein 4 | 10116 | RGD:3546 | Inparanoid, OMA, EggNOG |
| Dog | 477775 | RBP4 | retinol binding protein 4 | 9615 | VGNC:45432 | Inparanoid, OMA, EggNOG |
| Horse | 100049790 | RBP4 | retinol binding protein 4 | 9796 | VGNC:49533 | Inparanoid, OMA, EggNOG |
| Cow | 281444 | RBP4 | retinol binding protein 4 | 9913 | VGNC:33815 | Inparanoid, OMA, EggNOG |
| Pig | 397124 | RBP4 | retinol binding protein 4 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100023751 | RBP4 | retinol binding protein 4 | 13616 | | Inparanoid, EggNOG |
| Chicken | 396166 | RBP4A | retinol binding protein 4 A, plasma | 9031 | CGNC:49682 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100566565 | rbp4 | retinol binding protein 4 | 28377 | | Inparanoid, OMA |
| Xenopus | 548465 | rbp4 | retinol binding protein 4 | 8364 | XB-GENE-5841608 | Inparanoid, OMA |
| Zebrafish | 30077 | rbp4 | retinol binding protein 4, plasma | 7955 | ZDB-GENE-000210-19 | Inparanoid, OMA |
Protein Classes
DTO Classes protein /
Transporter / Retinol-binding protein 4
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
