JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Retinol-binding protein 4

Gene ID	5950
uniprot	P02753
Gene Name	RBP4
Ensernbl ID	ENSP00000360522
Family	Belongs to the calycin superfamily. Lipocalin family.
Sequence	MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	5950	RBP4	Retinol-binding protein 4	P02753
MOUSE		Rbp4	Uncharacterized protein	Q3TF08
MOUSE	19662	Rbp4	Retinol-binding protein 4	H7BWY6
MOUSE	19662	Rbp4	Retinol-binding protein 4	Q00724
RAT	25703	Rbp4	Retinol-binding protein	B2RZC1
RAT	25703	Rbp4	Retinol-binding protein 4	P04916

Protein Classes

PANTHER Classes
protein / transfer/carrier protein / Retinol-binding protein 4

DTO Classes
protein / Transporter / Retinol-binding protein 4

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: TCRDv6_DataSourcesLicenses.xlsx