The store will not work correctly when cookies are disabled.
Protein or Target Summary
Elongator complex protein 4
| Gene ID | 26610 |
|---|
| uniprot | Q96EB1 |
|---|
| Gene Name | ELP4 |
|---|
| Ensernbl ID | ENSP00000379267 |
|---|
| Family | Belongs to the ELP4 family. |
|---|
| Sequence | MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTVLLIEEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRFGHYYDASKRMPQELIEASNWHGFFLPEKISSTLKVEPCSLTPGYTKLLQFIQNIIYEEGFDGSNPQKKQRNILRIGIQNLGSPLWGDDICCAENGGNSHSLTKFLYVLRGLLRTSLSACIITMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIRQIPRLNNLICDESDVKDLAFKLKRKLFTIERLHLPPDLSDTVSRSSKMDLAESAKRLGPGCGMMAGGKKHLDF Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 26610 | ELP4 | Elongator complex protein 4 | Q96EB1 |
| MOUSE | 77766 | Elp4 | Elongator complex protein 4 | Q9ER73 |
| MOUSE | | Elp4 | Elongator complex protein 4 | A2A414 |
| RAT | 687694 | Elp4 | LOC687694 protein | B0BN35 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
