The store will not work correctly when cookies are disabled.
ELP4
| Description | Elongator complex protein 4 |
|---|
Gene and Protein Information
| Gene ID | 26610 |
|---|
| Uniprot Accession IDs | B4E3W0 E7EPZ6 Q9H4E8 Q9NX11 hELP4 |
|---|
| Ensembl ID | ENSP00000379267 |
|---|
| Symbol | C11orf19 PAXNEB AN AN2 hELP4 PAXNEB PAX6NEB C11orf19 dJ68P15A.1 |
|---|
| Family | Belongs to the ELP4 family. |
|---|
| Sequence | MAAVATCGSVAASTGSAVATASKSNVTSFQRRGPRASVTNDSGPRLVSIAGTRPSVRNGQLLVSTGLPALDQLLGGGLAVGTVLLIEEDKYNIYSPLLFKYFLAEGIVNGHTLLVASAKEDPANILQELPAPLLDDKCKKEFDEDVYNHKTPESNIKMKIAWRYQLLPKMEIGPVSSSRFGHYYDASKRMPQELIEASNWHGFFLPEKISSTLKVEPCSLTPGYTKLLQFIQNIIYEEGFDGSNPQKKQRNILRIGIQNLGSPLWGDDICCAENGGNSHSLTKFLYVLRGLLRTSLSACIITMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIRQIPRLNNLICDESDVKDLAFKLKRKLFTIERLHLPPDLSDTVSRSSKMDLAESAKRLGPGCGMMAGGKKHLDF Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 451103 | ELP4 | elongator acetyltransferase complex subunit 4 | 9598 | VGNC:11346 | Inparanoid, OMA, EggNOG |
| Mouse | 77766 | Elp4 | elongator acetyltransferase complex subunit 4 | 10090 | MGI:1925016 | Inparanoid, OMA, EggNOG |
| Rat | | AABR07053185.1 | - | 10116 | | OMA, EggNOG |
| Cow | 614139 | ELP4 | elongator acetyltransferase complex subunit 4 | 9913 | VGNC:28457 | Inparanoid, OMA, EggNOG |
| Pig | 100514702 | ELP4 | elongator acetyltransferase complex subunit 4 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100030999 | ELP4 | elongator acetyltransferase complex subunit 4 | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 428603 | ELP4 | elongator acetyltransferase complex subunit 4 | 9031 | CGNC:9198 | Inparanoid, OMA, EggNOG |
| Xenopus | 100485395 | elp4 | elongator acetyltransferase complex subunit 4 | 8364 | XB-GENE-991975 | Inparanoid, OMA, EggNOG |
| Zebrafish | 550331 | elp4 | elongator acetyltransferase complex subunit 4 | 7955 | ZDB-GENE-050417-114 | Inparanoid, OMA, EggNOG |
| C. elegans | 182929 | elpc-4 | Putative elongator complex protein 4 | 6239 | | Inparanoid, EggNOG |
| Fruitfly | 33775 | CG6907 | CG6907 gene product from transcript CG6907-RA | 7227 | FBgn0031711 | Inparanoid, EggNOG |
| S.cerevisiae | 856002 | ELP4 | Elongator subunit ELP4 | 4932 | S000006022 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
