The store will not work correctly when cookies are disabled.
RAMP2
| Description | Receptor activity-modifying protein 2 |
|---|
Gene and Protein Information
| Gene ID | 10266 |
|---|
| Uniprot Accession IDs | A7L9S6 K7EMD3 Q8N1F2 |
|---|
| Ensembl ID | ENSP00000253796 |
|---|
| Family | Belongs to the RAMP family. |
|---|
| Sequence | MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 454698 | RAMP2 | receptor activity modifying protein 2 | 9598 | VGNC:9553 | OMA, EggNOG |
| Macaque | 707718 | RAMP2 | receptor activity modifying protein 2 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 54409 | Ramp2 | receptor (calcitonin) activity modifying protein 2 | 10090 | MGI:1859650 | Inparanoid, OMA, EggNOG |
| Rat | 58966 | Ramp2 | receptor activity modifying protein 2 | 10116 | RGD:61872 | Inparanoid, OMA, EggNOG |
| Dog | 480515 | RAMP2 | receptor activity modifying protein 2 | 9615 | | Inparanoid, OMA, EggNOG |
| Horse | | RAMP2 | receptor activity modifying protein 2 [Source:HGNC Symbol;Acc:HGNC:9844] | 9796 | | OMA, EggNOG |
| Cow | 504230 | RAMP2 | receptor activity modifying protein 2 | 9913 | VGNC:33707 | Inparanoid, OMA, EggNOG |
| Pig | 397155 | RAMP2 | receptor activity modifying protein 2 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100011362 | RAMP2 | receptor activity modifying protein 2 | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 420022 | RAMP2 | receptor activity modifying protein 2 | 9031 | CGNC:17380 | Inparanoid, EggNOG |
| Anole lizard | | RAMP2 | receptor activity modifying protein 2 [Source:HGNC Symbol;Acc:HGNC:9844] | 28377 | | Inparanoid, EggNOG |
Protein Classes
PANTHER Classes protein /
receptor / Receptor activity-modifying protein 2
DTO Classes protein /
Receptor / Receptor activity-modifying protein 2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
