The store will not work correctly when cookies are disabled.
PGAM1
| Description | Phosphoglycerate mutase 1 |
|---|
Gene and Protein Information
| Gene ID | 5223 |
|---|
| Uniprot Accession IDs | Q9BWC0 |
|---|
| Ensembl ID | ENSP00000359991 |
|---|
| Symbol | PGAMA PGAMA PGAM-B HEL-S-35 |
|---|
| Family | Belongs to the phosphoglycerate mutase family. BPG-dependent PGAM subfamily. |
|---|
| Sequence | MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK |
|---|
Homologous gene and protein info.
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
