The store will not work correctly when cookies are disabled.
Protein or Target Summary
Phosphoglycerate mutase 1
| Gene ID | 5223 |
|---|
| uniprot | P18669 |
|---|
| Gene Name | PGAM1 |
|---|
| Ensernbl ID | ENSP00000359991 |
|---|
| Family | Belongs to the phosphoglycerate mutase family. BPG-dependent PGAM subfamily. |
|---|
| Sequence | MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5223 | PGAM1 | Phosphoglycerate mutase 1 | P18669 |
| MOUSE | | Pgam1 | Pgam1 protein | Q6NWV5 |
| MOUSE | 18648 | Pgam1 | Phosphoglycerate mutase | Q3U7Z6 |
| MOUSE | 18648 | Pgam1 | Phosphoglycerate mutase 1 | Q9DBJ1 |
| RAT | 24642 | Pgam1 | Phosphoglycerate mutase 1 | P25113 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
