The store will not work correctly when cookies are disabled.
RAMP1
| Description | Receptor activity-modifying protein 1 |
|---|
Gene and Protein Information
| Gene ID | 10267 |
|---|
| Uniprot Accession IDs | Q6FGS5 |
|---|
| Ensembl ID | ENSP00000254661 |
|---|
| Family | Belongs to the RAMP family. |
|---|
| Sequence | MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Mouse | 51801 | Ramp1 | receptor (calcitonin) activity modifying protein 1 | 10090 | MGI:1858418 | Inparanoid, OMA, EggNOG |
| Rat | 58965 | Ramp1 | receptor activity modifying protein 1 | 10116 | RGD:61870 | Inparanoid, OMA, EggNOG |
| Dog | | RAMP1 | receptor activity modifying protein 1 [Source:HGNC Symbol;Acc:HGNC:9843] | 9615 | | OMA, EggNOG |
| Horse | 100066550 | RAMP1 | receptor activity modifying protein 1 | 9796 | VGNC:22168 | Inparanoid, OMA, EggNOG |
| Cow | 617017 | RAMP1 | receptor activity modifying protein 1 | 9913 | | Inparanoid, EggNOG |
| Pig | 397401 | RAMP1 | receptor activity modifying protein 1 | 9823 | | Inparanoid, OMA, EggNOG |
| Chicken | 424016 | RAMP1 | receptor activity modifying protein 1 | 9031 | CGNC:2798 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100563905 | ramp1 | receptor activity modifying protein 1 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 780274 | ramp1 | receptor (G protein-coupled) activity modifying protein 1 | 8364 | XB-GENE-1010532 | Inparanoid, OMA, EggNOG |
| Zebrafish | 436966 | zgc:91818 | zgc:91818 | 7955 | ZDB-GENE-040718-446 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes protein /
receptor / Receptor activity-modifying protein 1
DTO Classes protein /
Receptor / Receptor activity-modifying protein 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
