JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Transforming protein RhoA

Gene ID	387
uniprot	P61586
Gene Name	RHOA
Ensernbl ID	ENSP00000400175
Family	Belongs to the small GTPase superfamily. Rho family.
Sequence	MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	387	RHOA	Transforming protein RhoA	P61586
MOUSE		Rhoa	Transforming protein RhoA	A0A0A6YWJ1
MOUSE		Rhoa	Uncharacterized protein	Q3TN61
MOUSE		Rhoa	Transforming protein RhoA	A0A0A6YXF6
MOUSE	11848	Rhoa	Ras family member A	Q4VAE6
MOUSE	11848	Rhoa	Transforming protein RhoA	Q9QUI0
RAT		rhoA	RhoA	O35791
RAT	117273	Rhoa	Transforming protein RhoA	P61589

Protein Classes

PANTHER Classes
protein / enzyme modulator / small GTPase / Transforming protein RhoA

DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / Transforming protein RhoA

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx