JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

GTPase KRas

Gene ID	3845
uniprot	P01116
Gene Name	KRAS
Ensernbl ID	ENSP00000256078
Family	Belongs to the small GTPase superfamily. Ras family.
Sequence	MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	3845	KRAS	GTPase KRas	P01116
MOUSE	16653	Kras	GTPase KRas	P32883
MOUSE		Kras	Uncharacterized protein	Q3U2W7
MOUSE		Kras	GTPase KRas	E9Q8V2
MOUSE		Kras	GTPase KRas	A0A0N4SVY1
MOUSE		Kras	GTPase KRas	B2KGV5
MOUSE	16653	Kras	Kras protein	Q0VDV7
MOUSE	16653	Kras	Kras protein	Q5J7N1
RAT	24525	Kras	V-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog	A0JN17
RAT	24525	Kras	GTPase KRas	P08644

Protein Classes

PANTHER Classes
protein / enzyme modulator / small GTPase / GTPase KRas

DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / GTPase KRas

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx