Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

REN

DescriptionRenin

Gene and Protein Information

Gene ID5972
Uniprot Accession IDs Q6FI38 Q6T5C2
Ensembl ID ENSP00000272190
Symbol HNFJ2
FamilyBelongs to the peptidase A1 family.
Sequence
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp469651RENrenin9598VGNC:6977Inparanoid, OMA, EggNOG
Macaque574299RENrenin9544Inparanoid, OMA, EggNOG
Mouse19701Ren1renin 1 structural10090MGI:97898OMA, EggNOG
Rat24715Renrenin10116RGD:3554Inparanoid, OMA, EggNOG
Dog403838RENrenin9615VGNC:45474Inparanoid, OMA, EggNOG
Horse100054248RENrenin9796VGNC:22299Inparanoid, OMA, EggNOG
Cow280909RENrenin9913VGNC:33865Inparanoid, OMA, EggNOG
Opossum100017089LOC100017089renin-like13616OMA, EggNOG
Platypus100092330CTSEcathepsin E9258OMA, EggNOG
Anole lizard100557560renrenin28377Inparanoid, OMA
Xenopus100487524renrenin8364XB-GENE-480535Inparanoid, OMA
Zebrafish405786renrenin7955ZDB-GENE-040630-3Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    aspartic protease    /    Renin
protein    /    protease    /    Renin
protein    /    hydrolase    /    Renin
DTO Classes
protein    /    Enzyme    /    Protease    /    Aspartic protease    /    Renin

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.