Protein or Target Summary
Gamma-aminobutyric acid receptor-associated protein-like 1
Gene ID | 23710 |
---|---|
uniprot | Q9H0R8 |
Gene Name | GABARAPL1 |
Ensernbl ID | ENSP00000266458 |
Family | Belongs to the ATG8 family. |
Sequence | MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK Show more |
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|---|---|---|---|
HUMAN | 23710 | GABARAPL1 | Gamma-aminobutyric acid receptor-associated protein-like 1 | Q9H0R8 |
MOUSE | 57436 | Gabarapl1 | Gamma-aminobutyric acid receptor-associated protein-like 1 | Q8R3R8 |
MOUSE | Gabarapl1 | Gamma-aminobutyric acid receptor-associated protein-like 1 | A0A0N4SUS3 | |
MOUSE | Gabarapl1 | Gamma-aminobutyric acid receptor-associated protein-like 1 | A0A0N4SVF3 | |
RAT | 689161 | Gabarapl1 | Gamma-aminobutyric acid receptor-associated protein-like 1 | Q0VGK0 |
Protein Classes
PANTHER Classes
protein / cytoskeletal protein / non-motor microtubule binding protein / Gamma-aminobutyric acid receptor-associated protein-like 1
protein / cytoskeletal protein / non-motor microtubule binding protein / Gamma-aminobutyric acid receptor-associated protein-like 1
DTO Classes
protein / Cellular structure / Microtubule family cytoskeletal protein / Non-motor microtubule binding protein / Gamma-aminobutyric acid receptor-associated protein-like 1
protein / Cellular structure / Microtubule family cytoskeletal protein / Non-motor microtubule binding protein / Gamma-aminobutyric acid receptor-associated protein-like 1
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx