The store will not work correctly when cookies are disabled.
Protein or Target Summary
Programmed cell death protein 6
| Gene ID | 10016 |
|---|
| uniprot | O75340 |
|---|
| Gene Name | PDCD6 |
|---|
| Ensernbl ID | ENSP00000264933 |
|---|
| Sequence | MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 10016 | PDCD6 | Programmed cell death protein 6 | O75340 |
| MOUSE | | Pdcd6 | Uncharacterized protein | Q8C5M4 |
| MOUSE | | Pdcd6 | Programmed cell death 6, isoform CRA_a | Q3UGE5 |
| MOUSE | 18570 | Pdcd6 | Programmed cell death protein 6 | P12815 |
| RAT | 308061 | Pdcd6 | Programmed cell death protein 6 | G3V7W1 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
