Click Here for 5% Off Your First Aladdin Purchase!
Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

Protein or Target Summary

Cytochrome c oxidase subunit 6B1

Gene ID1340
uniprotP14854
Gene NameCOX6B1
Ensernbl IDENSP00000246554
FamilyBelongs to the cytochrome c oxidase subunit 6B family.
Sequence
MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN1340COX6B1Cytochrome c oxidase subunit 6B1P14854
MOUSE110323Cox6b1Cytochrome c oxidase subunit 6B1P56391
MOUSECox6b1Cytochrome c oxidase subunit 6B1A0A140LIU3
RATCox6b1Cytochrome c oxidase subunit 6B1P80430
RATCox6b1Cytochrome c oxidase subunit 6B1D3ZSB0
RAT688869Cox6b1Cytochrome c oxidase subunitD3ZD09

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      Source: DataSourcesLicenses.xlsx
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.