The store will not work correctly when cookies are disabled.
RAC1
| Description | Ras-related C3 botulinum toxin substrate 1 |
|---|
Gene and Protein Information
| Gene ID | 5879 |
|---|
| Uniprot Accession IDs | O95501 P15154 Q3Y4D3 Q5JAA8 Q9BTB4 |
|---|
| Ensembl ID | ENSP00000348461 |
|---|
| Symbol | TC25 MIG5 MRD48 Rac-1 TC-25 p21-Rac1 |
|---|
| Family | Belongs to the small GTPase superfamily. Rho family. |
|---|
| Sequence | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 741907 | RAC1 | ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) | 9598 | | OMA, EggNOG |
| Mouse | 19353 | Rac1 | Rac family small GTPase 1 | 10090 | MGI:97845 | Inparanoid, OMA |
| Rat | 363875 | Rac1 | Rac family small GTPase 1 | 10116 | RGD:619755 | Inparanoid, OMA |
| Dog | 403955 | RAC1 | Rac family small GTPase 1 | 9615 | VGNC:49609 | Inparanoid, OMA |
| Cow | 281440 | RAC1 | Rac family small GTPase 1 | 9913 | | Inparanoid, OMA |
| Opossum | 100026992 | RAC1 | Rac family small GTPase 1 | 13616 | | Inparanoid, OMA |
| Platypus | 100076220 | RAC1 | Rac family small GTPase 1 | 9258 | | Inparanoid, OMA |
| Anole lizard | 100561917 | rac1 | Rac family small GTPase 1 | 28377 | | Inparanoid, OMA |
| Xenopus | 448118 | rac1 | Rac family small GTPase 1 | 8364 | XB-GENE-489008 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
