Protein or Target Summary
Ras-related C3 botulinum toxin substrate 1
| Gene ID | 5879 |
|---|---|
| uniprot | P63000 |
| Gene Name | RAC1 |
| Ensernbl ID | ENSP00000348461 |
| Family | Belongs to the small GTPase superfamily. Rho family. |
| Sequence | MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 5879 | RAC1 | Ras-related C3 botulinum toxin substrate 1 | P63000 |
| MOUSE | Rac1 | Uncharacterized protein | Q9D859 | |
| MOUSE | Rac1 | Uncharacterized protein | Q8C4N8 | |
| MOUSE | Rac1 | Ribonuclease A c1 | W0UVC3 | |
| MOUSE | Rac1 | Uncharacterized protein | Q8BPG5 | |
| MOUSE | 19353 | Rac1 | RAS-related C3 botulinum substrate 1 | K7Q7T7 |
| MOUSE | 19353 | Rac1 | RAS-related C3 botulinum substrate 1, isoform CRA_a | Q3TLP8 |
| MOUSE | 19353 | Rac1 | Ras-related C3 botulinum toxin substrate 1 | P63001 |
| RAT | Rac1 | Ras-related C3 botulinum toxin substrate 1 | A0A0U1RS21 | |
| RAT | Rac1 | Ras-related C3 botulinum toxin substrate 1 | A0A0G2K0X4 | |
| RAT | Rac1 | Ras-related C3 botulinum toxin substrate 1 | A0A0U1RS18 | |
| RAT | 363875 | Rac1 | Ras-related C3 botulinum toxin substrate 1 | Q6RUV5 |
Protein Classes
PANTHER Classes
protein / enzyme modulator / small GTPase / Ras-related C3 botulinum toxin substrate 1
protein / enzyme modulator / small GTPase / Ras-related C3 botulinum toxin substrate 1
DTO Classes
protein / Enzyme modulator / G-protein / Small GTPase / Ras-related C3 botulinum toxin substrate 1
protein / Enzyme modulator / G-protein / Small GTPase / Ras-related C3 botulinum toxin substrate 1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx