The store will not work correctly when cookies are disabled.
Protein or Target Summary
Cellular retinoic acid-binding protein 2
| Gene ID | 1382 |
|---|
| uniprot | P29373 |
|---|
| Gene Name | CRABP2 |
|---|
| Ensernbl ID | ENSP00000482841 |
|---|
| Family | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
|---|
| Sequence | MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 1382 | CRABP2 | Cellular retinoic acid-binding protein 2 | P29373 |
| MOUSE | 12904 | Crabp2 | Cellular retinoic acid-binding protein 2 | P22935 |
| RAT | | Crabp2 | Cellular retinoic acid-binding protein 2 | M0RCE3 |
| RAT | 29563 | Crabp2 | Cellular retinoic acid-binding protein 2 | P51673 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
