Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

CRABP2

DescriptionCellular retinoic acid-binding protein 2

Gene and Protein Information

Gene ID1382
Uniprot Accession IDs B2R4Z8 D3DVC5 F1T098 Q6ICN6
Ensembl ID ENSP00000482841
Symbol RBP6 CRABP-II
FamilyBelongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Sequence
MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp469838CRABP2cellular retinoic acid binding protein 29598VGNC:509OMA, EggNOG
Macaque718579CRABP2cellular retinoic acid binding protein 29544Inparanoid, OMA, EggNOG
Mouse12904Crabp2cellular retinoic acid binding protein II10090MGI:88491Inparanoid, OMA, EggNOG
Rat29563Crabp2cellular retinoic acid binding protein 210116RGD:62070Inparanoid, OMA, EggNOG
Dog612093CRABP2cellular retinoic acid binding protein 29615VGNC:39588Inparanoid, OMA, EggNOG
Horse100058072CRABP2cellular retinoic acid binding protein 29796VGNC:16847Inparanoid, OMA, EggNOG
Cow493998CRABP2cellular retinoic acid binding protein 29913VGNC:27686Inparanoid, OMA, EggNOG
Pig100155151CRABP2cellular retinoic acid binding protein 29823Inparanoid, OMA, EggNOG
Opossum100018489CRABP2cellular retinoic acid binding protein 213616Inparanoid, OMA, EggNOG
Anole lizard100556219crabp2cellular retinoic acid binding protein 228377Inparanoid, OMA
Xenopus448629crabp2cellular retinoic acid binding protein 28364XB-GENE-959098Inparanoid, OMA
Zebrafish503502crabp2bcellular retinoic acid binding protein 2, b7955ZDB-GENE-050208-52Inparanoid, OMA

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details
CRABP2 Mouse mAbHuman,Pig,Rat
  • WB
In stock
Expand

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid
      breast carcinoma2011Expression AtlasMONDO:0004989
      ductal carcinoma in situ1737Expression AtlasMONDO:0005023
      endometriosis473Expression AtlasMONDO:0005133
      esophageal adenocarcinoma754Expression AtlasMONDO:0005028
      facioscapulohumeral dystrophy399Expression AtlasMONDO:0001347
      group 3 medulloblastoma7142Expression AtlasMONDO:0007959
      interstitial cystitis2307Expression AtlasMONDO:0018301
      invasive ductal carcinoma2965Expression AtlasMONDO:0004953
      lung adenocarcinoma2873Expression AtlasMONDO:0005061
      lung cancer4468Expression AtlasMONDO:0008903

      Bibliography

      1.Chaudhuri, B N BN and 7 more authors. 1999-11 Structures of cellular retinoic acid binding proteins I and II in complex with synthetic retinoids. [PMID:10531482]
      2.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]
      3.Despouy, Gilles G and 7 more authors. 2003-02-21 Cyclin D3 is a cofactor of retinoic acid receptors, modulating their activity in the presence of cellular retinoic acid-binding protein II. [PMID:12482873]
      4.Behrens, G M N GM, Genschel, J J, Schmidt, R E RE and Schmidt, H H-J HH. 2003-05-30 Lack of mutations in LMNA, its promoter region, and the cellular retinoic acid binding protein II (CRABP II) in HIV associated lipodystrophy. [PMID:12844477]
      5.Eller, M S MS, Oleksiak, M F MF, McQuaid, T J TJ, McAfee, S G SG and Gilchrest, B A BA. 1992-02 The molecular cloning and expression of two CRABP cDNAs from human skin. [PMID:1309505]
      6.Elder, J T JT, Aström, A A, Pettersson, U U, Voorhees, J J JJ and Trent, J M JM. 1992-07 Assignment of the human CRABP-II gene to chromosome 1q21 by nonisotopic in situ hybridization. [PMID:1321791]
      7.Aström, A A, Pettersson, U U and Voorhees, J J JJ. 1992-12-15 Structure of the human cellular retinoic acid-binding protein II gene. Early transcriptional regulation by retinoic acid. [PMID:1334086]
      8.Van den Bogaerdt, Antoon J AJ and 7 more authors. 2004-03-05 Differential expression of CRABP-II in fibroblasts derived from dermis and subcutaneous fat. [PMID:14766225]
      9.Gimeno, Amparo A, Zaragozá, Rosa R, Viña, Juan R JR and Miralles, Vicente J VJ. 2004-07-02 Vitamin E activates CRABP-II gene expression in cultured human fibroblasts, role of protein kinase C. [PMID:15225641]
      10.Suzuki, Yutaka Y and 7 more authors. 2004-09 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions. [PMID:15342556]