The store will not work correctly when cookies are disabled.
Protein or Target Summary
Receptor activity-modifying protein 3
| Gene ID | 10268 |
|---|
| uniprot | O60896 |
|---|
| Gene Name | RAMP3 |
|---|
| Ensernbl ID | ENSP00000242249 |
|---|
| Family | Belongs to the RAMP family. |
|---|
| Sequence | METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 10268 | RAMP3 | Receptor activity-modifying protein 3 | O60896 |
| MOUSE | 56089 | Ramp3 | Receptor activity-modifying protein 3 | Q9WUP1 |
| RAT | 56820 | Ramp3 | Receptor activity-modifying protein 3 | Q9JJ73 |
| RAT | | RAMP3 | Receptor activity modifying protein 3 | Q9WVQ2 |
| RAT | | RAMP3 | Receptor activity modifying protein 3 | Q9JMD8 |
Protein Classes
PANTHER Classes protein /
receptor / Receptor activity-modifying protein 3
DTO Classes protein /
Receptor / Receptor activity-modifying protein 3
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
