The store will not work correctly when cookies are disabled.
RAMP3
| Description | Receptor activity-modifying protein 3 |
|---|
Gene and Protein Information
| Gene ID | 10268 |
|---|
| Uniprot Accession IDs | Q7Z2Y1 |
|---|
| Ensembl ID | ENSP00000242249 |
|---|
| Family | Belongs to the RAMP family. |
|---|
| Sequence | METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 739151 | RAMP3 | receptor activity modifying protein 3 | 9598 | VGNC:14081 | OMA, EggNOG |
| Mouse | 56089 | Ramp3 | receptor (calcitonin) activity modifying protein 3 | 10090 | MGI:1860292 | Inparanoid, OMA, EggNOG |
| Rat | 56820 | Ramp3 | receptor activity modifying protein 3 | 10116 | RGD:61873 | Inparanoid, OMA |
| Dog | 100855938 | RAMP3 | receptor activity modifying protein 3 | 9615 | VGNC:54348 | Inparanoid, OMA, EggNOG |
| Horse | | RAMP3 | receptor activity modifying protein 3 [Source:HGNC Symbol;Acc:HGNC:9845] | 9796 | | OMA, EggNOG |
| Cow | 613547 | RAMP3 | receptor activity modifying protein 3 | 9913 | VGNC:33708 | Inparanoid, OMA, EggNOG |
| Opossum | 100030491 | RAMP3 | receptor activity modifying protein 3 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | | RAMP3 | receptor activity modifying protein 3 [Source:HGNC Symbol;Acc:HGNC:9845] | 9258 | | OMA, EggNOG |
| Anole lizard | 100555378 | ramp3 | receptor activity modifying protein 3 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | | ramp3 | receptor (G protein-coupled) activity modifying protein 3 [Source:Xenbase;Acc:XB-GENE-983292] | 8364 | | OMA, EggNOG |
Protein Classes
PANTHER Classes protein /
receptor / Receptor activity-modifying protein 3
DTO Classes protein /
Receptor / Receptor activity-modifying protein 3
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
