The store will not work correctly when cookies are disabled.
PDGFC
| Description | Platelet-derived growth factor C |
|---|
Gene and Protein Information
| Gene ID | 56034 |
|---|
| Uniprot Accession IDs | B4DU34 B9EGR8 Q4W5M9 Q9UL22 PDGF-C |
|---|
| Ensembl ID | ENSP00000422464 |
|---|
| Symbol | SCDGF SCDGF FALLOTEIN |
|---|
| Family | Belongs to the PDGF/VEGF growth factor family. |
|---|
| Sequence | MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 736477 | PDGFC | platelet derived growth factor C | 9598 | VGNC:657 | OMA, EggNOG |
| Macaque | 700236 | PDGFC | platelet derived growth factor C | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 54635 | Pdgfc | platelet-derived growth factor, C polypeptide | 10090 | MGI:1859631 | Inparanoid, OMA, EggNOG |
| Rat | 79429 | Pdgfc | platelet derived growth factor C | 10116 | RGD:68410 | Inparanoid, OMA, EggNOG |
| Dog | 482666 | PDGFC | platelet derived growth factor C | 9615 | VGNC:44370 | Inparanoid, OMA, EggNOG |
| Horse | 100062015 | PDGFC | platelet derived growth factor C | 9796 | VGNC:21259 | Inparanoid, OMA, EggNOG |
| Cow | 613787 | PDGFC | platelet derived growth factor C | 9913 | VGNC:53915 | Inparanoid, OMA, EggNOG |
| Pig | 100515267 | PDGFC | platelet derived growth factor C | 9823 | | OMA, EggNOG |
| Opossum | 100023701 | PDGFC | platelet derived growth factor C | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100079757 | PDGFC | platelet derived growth factor C | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 395469 | PDGFC | platelet derived growth factor C | 9031 | CGNC:7129 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100568114 | pdgfc | platelet derived growth factor C | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100494492 | pdgfc | platelet derived growth factor C | 8364 | XB-GENE-985688 | Inparanoid, OMA, EggNOG |
| Zebrafish | 560564 | pdgfc | platelet derived growth factor c | 7955 | ZDB-GENE-071217-2 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
