JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
RBBP7

RBBP7

Description	Histone-binding protein RBBP7

Gene and Protein Information

Gene ID	5931
Uniprot Accession IDs	Q5JP00
Ensembl ID	ENSP00000369424
Symbol	RBAP46 RbAp46
Family	Belongs to the WD repeat RBAP46/RBAP48/MSI1 family.
Sequence	MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	465518	RBBP7	RB binding protein 7, chromatin remodeling factor	9598	VGNC:1203	Inparanoid, OMA, EggNOG
Macaque	713843	RBBP7	RB binding protein 7, chromatin remodeling factor	9544		Inparanoid, OMA
Mouse	245688	Rbbp7	retinoblastoma binding protein 7, chromatin remodeling factor	10090	MGI:1194910	Inparanoid, OMA
Rat	83712	Rbbp7	RB binding protein 7, chromatin remodeling factor	10116	RGD:620125	Inparanoid, OMA
Dog	480854	RBBP7	RB binding protein 7, chromatin remodeling factor	9615	VGNC:45393	Inparanoid, OMA
Horse	100056761	RBBP7	RB binding protein 7, chromatin remodeling factor	9796	VGNC:22221	Inparanoid, OMA
Cow	537402	RBBP7	RB binding protein 7, chromatin remodeling factor	9913	VGNC:33772	Inparanoid, OMA
Opossum	100016649	RBBP7	RB binding protein 7, chromatin remodeling factor	13616		Inparanoid, OMA
Platypus	100085544	RBBP7	RB binding protein 7, chromatin remodeling factor	9258		Inparanoid, OMA
Chicken	395390	RBBP7	RB binding protein 7, chromatin remodeling factor	9031	CGNC:12390	Inparanoid, OMA
Xenopus	394900	rbbp7	retinoblastoma binding protein 7	8364	XB-GENE-487909	Inparanoid, OMA, EggNOG
C. elegans	172802	lin-53	Probable histone-binding protein lin-53	6239		Inparanoid, OMA
S.cerevisiae	856654	HAT2	Hat2p	4932	S000000782	Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]