The store will not work correctly when cookies are disabled.
DUSP3
| Description | Dual specificity protein phosphatase 3 |
|---|
Gene and Protein Information
| Gene ID | 1845 |
|---|
| Uniprot Accession IDs | D3DX45 Q5U0J1 Q8IYJ9 |
|---|
| Ensembl ID | ENSP00000226004 |
|---|
| Symbol | VHR VHR |
|---|
| Family | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. |
|---|
| Sequence | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 468271 | DUSP3 | dual specificity phosphatase 3 | 9598 | VGNC:12093 | OMA, EggNOG |
| Macaque | 713686 | DUSP3 | dual specificity phosphatase 3 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 72349 | Dusp3 | dual specificity phosphatase 3 (vaccinia virus phosphatase VH1-related) | 10090 | MGI:1919599 | Inparanoid, OMA, EggNOG |
| Rat | 498003 | Dusp3 | dual specificity phosphatase 3 | 10116 | RGD:1560049 | Inparanoid, OMA, EggNOG |
| Dog | 480505 | DUSP3 | dual specificity phosphatase 3 | 9615 | VGNC:53236 | Inparanoid, OMA, EggNOG |
| Horse | 100064999 | DUSP3 | dual specificity phosphatase 3 | 9796 | VGNC:51807 | Inparanoid, OMA, EggNOG |
| Cow | 615432 | DUSP3 | dual specificity phosphatase 3 | 9913 | VGNC:28259 | Inparanoid, OMA, EggNOG |
| Pig | 100512983 | DUSP3 | dual specificity phosphatase 3 | 9823 | | OMA, EggNOG |
| Opossum | | DUSP3 | dual specificity phosphatase 3 [Source:HGNC Symbol;Acc:HGNC:3069] | 13616 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100555344 | dusp3 | dual specificity phosphatase 3 | 28377 | | Inparanoid, OMA, EggNOG |
| Zebrafish | 100000665 | dusp3a | dual specificity phosphatase 3a | 7955 | ZDB-GENE-111207-3 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
