The store will not work correctly when cookies are disabled.
Protein or Target Summary
Dual specificity protein phosphatase 3
| Gene ID | 1845 |
|---|
| uniprot | P51452 |
|---|
| Gene Name | DUSP3 |
|---|
| Ensernbl ID | ENSP00000226004 |
|---|
| Family | Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily. |
|---|
| Sequence | MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVLNAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 1845 | DUSP3 | Dual specificity protein phosphatase 3 | P51452 |
| MOUSE | 72349 | Dusp3 | Dual specificity protein phosphatase 3 | Q9D7X3 |
| MOUSE | | Dusp3 | Dual-specificity protein phosphatase 3 | H3BKL8 |
| MOUSE | | Dusp3 | Dual-specificity protein phosphatase 3 | B1AQF4 |
| MOUSE | | Dusp3 | Dual-specificity protein phosphatase 3 | H3BLK2 |
| MOUSE | | Dusp3 | Dual-specificity protein phosphatase 3 | H3BKD1 |
| MOUSE | | Dusp3 | Dual-specificity protein phosphatase 3 | Q3V2Y9 |
| RAT | | Dusp3 | Dusp3 protein | B5DFF7 |
| RAT | 498003 | Dusp3 | Dual-specificity phosphatase 3 | G3V9L3 |
| RAT | | Dusp3 | Dual-specificity phosphatase 3 | A0A0G2K3I9 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
