The store will not work correctly when cookies are disabled.
Protein or Target Summary
Quinone oxidoreductase
| Gene ID | 1429 |
|---|
| uniprot | Q08257 |
|---|
| Gene Name | CRYZ |
|---|
| Ensernbl ID | ENSP00000399805 |
|---|
| Family | Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily. |
|---|
| Sequence | MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 1429 | CRYZ | Quinone oxidoreductase | Q08257 |
| MOUSE | | Cryz | Uncharacterized protein | Q3UYY0 |
| MOUSE | | Cryz | Crystallin, zeta | Q80XR3 |
| MOUSE | | Cryz | Quinone oxidoreductase | A0A0A6YVS7 |
| MOUSE | | Cryz | Quinone oxidoreductase | V9GXY8 |
| MOUSE | | Cryz | Quinone oxidoreductase | A0A0G2JFU5 |
| MOUSE | | Cryz | Quinone oxidoreductase | A0A0A6YXR4 |
| MOUSE | | Cryz | Quinone oxidoreductase | D3Z4Q4 |
| MOUSE | | Cryz | Quinone oxidoreductase | D3YUG9 |
| MOUSE | | Cryz | Quinone oxidoreductase | D3YWU6 |
| MOUSE | | Cryz | Quinone oxidoreductase | D3Z2X0 |
| MOUSE | 12972 | Cryz | Quinone oxidoreductase | P47199 |
| RAT | 362061 | Cryz | Quinone oxidoreductase | Q6AYT0 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
