The store will not work correctly when cookies are disabled.
Protein or Target Summary
Ras-related protein Rab-4A
| Gene ID | 5867 |
|---|
| uniprot | P20338 |
|---|
| Gene Name | RAB4A |
|---|
| Ensernbl ID | ENSP00000355651 |
|---|
| Family | Belongs to the small GTPase superfamily. Rab family. |
|---|
| Sequence | MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 5867 | RAB4A | Ras-related protein Rab-4A | P20338 |
| MOUSE | 19341 | Rab4a | Ras-related protein Rab-4A | P56371 |
| MOUSE | 19341 | Rab4a | Uncharacterized protein | Q3ULK1 |
| MOUSE | | Rab4a | RAB4A, member RAS oncogene family | B2RRN5 |
| MOUSE | | Rab4a | Ras-related protein Rab-4A | A0A1D5RMH1 |
| RAT | 25532 | Rab4a | Ras-related protein Rab-4A | P05714 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
