Protein or Target Summary
Retinoic acid receptor beta
| Gene ID | 5915 |
|---|---|
| uniprot | P10826 |
| Gene Name | RARB |
| Ensernbl ID | ENSP00000332296 |
| Family | Belongs to the nuclear hormone receptor family. NR1 subfamily. |
| Sequence | MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPATIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 5915 | RARB | Retinoic acid receptor beta | P10826 |
| MOUSE | Rarb | Retinoic acid receptor beta | A0A286YCH1 | |
| MOUSE | Rarb | Retinoic acid receptor beta | A0A286YE15 | |
| MOUSE | Rarb | Retinoic acid receptor beta | A0A286YCR2 | |
| MOUSE | Rarb | Retinoic acid receptor beta | A0A286YDP5 | |
| MOUSE | Rarb | Retinoic acid receptor beta | A0A286YCX1 | |
| MOUSE | 218772 | Rarb | Retinoic acid receptor, beta | Q6DFX0 |
| MOUSE | 218772 | Rarb | Retinoic acid receptor beta | P22605 |
| RAT | 24706 | Rarb | Retinoic acid receptor, beta | D3ZFD9 |
Protein Classes
PANTHER Classes
protein / transcription factor / Retinoic acid receptor beta
protein / receptor / Retinoic acid receptor beta
protein / nucleic acid binding / Retinoic acid receptor beta
protein / C4 zinc finger nuclear receptor / Retinoic acid receptor beta
protein / transcription factor / Retinoic acid receptor beta
protein / receptor / Retinoic acid receptor beta
protein / nucleic acid binding / Retinoic acid receptor beta
protein / C4 zinc finger nuclear receptor / Retinoic acid receptor beta
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx