| Description | Retinoic acid receptor beta |
|---|
Gene and Protein Information
| Gene ID | 5915 |
|---|---|
| Uniprot Accession IDs | P12891 Q00989 Q15298 Q9UN48 RAR-beta |
| Ensembl ID | ENSP00000332296 |
| Symbol | HAP NR1B2 HAP RRB2 NR1B2 MCOPS12 RARbeta1 |
| Family | Belongs to the nuclear hormone receptor family. NR1 subfamily. |
| Sequence | MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPATIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 745516 | RARB | retinoic acid receptor beta | 9598 | VGNC:7111 | OMA, EggNOG |
| Macaque | 700485 | RARB | retinoic acid receptor beta | 9544 | OMA, EggNOG | |
| Mouse | 218772 | Rarb | retinoic acid receptor, beta | 10090 | MGI:97857 | Inparanoid, OMA |
| Rat | 24706 | Rarb | retinoic acid receptor, beta | 10116 | RGD:3535 | Inparanoid, OMA |
| Dog | 477045 | RARB | retinoic acid receptor beta | 9615 | VGNC:45352 | Inparanoid, OMA, EggNOG |
| Horse | 100051546 | RARB | retinoic acid receptor beta | 9796 | VGNC:22185 | Inparanoid, OMA, EggNOG |
| Opossum | 100024675 | RARB | retinoic acid receptor beta | 13616 | Inparanoid, OMA | |
| Platypus | RARB | retinoic acid receptor beta [Source:HGNC Symbol;Acc:HGNC:9865] | 9258 | OMA, EggNOG | ||
| Chicken | 396266 | RARB | retinoic acid receptor beta | 9031 | CGNC:8589 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100562902 | rarb | retinoic acid receptor beta | 28377 | Inparanoid, OMA | |
| Xenopus | 100488600 | rarb | retinoic acid receptor beta | 8364 | XB-GENE-481009 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / transcription factor / Retinoic acid receptor beta
protein / receptor / Retinoic acid receptor beta
protein / nucleic acid binding / Retinoic acid receptor beta
protein / C4 zinc finger nuclear receptor / Retinoic acid receptor beta
protein / transcription factor / Retinoic acid receptor beta
protein / receptor / Retinoic acid receptor beta
protein / nucleic acid binding / Retinoic acid receptor beta
protein / C4 zinc finger nuclear receptor / Retinoic acid receptor beta
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|