Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

RARB

DescriptionRetinoic acid receptor beta

Gene and Protein Information

Gene ID5915
Uniprot Accession IDs P10826 P12891 Q00989 Q15298 Q9UN48 RAR-beta
Ensembl ID ENSP00000332296
Symbol HAP NR1B2 HAP RRB2 NR1B2 MCOPS12 RARbeta1
FamilyBelongs to the nuclear hormone receptor family. NR1 subfamily.
Sequence
MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPATIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp745516RARBretinoic acid receptor beta9598VGNC:7111OMA, EggNOG
Macaque700485RARBretinoic acid receptor beta9544OMA, EggNOG
Mouse218772Rarbretinoic acid receptor, beta10090MGI:97857Inparanoid, OMA
Rat24706Rarbretinoic acid receptor, beta10116RGD:3535Inparanoid, OMA
Dog477045RARBretinoic acid receptor beta9615VGNC:45352Inparanoid, OMA, EggNOG
Horse100051546RARBretinoic acid receptor beta9796VGNC:22185Inparanoid, OMA, EggNOG
Opossum100024675RARBretinoic acid receptor beta13616Inparanoid, OMA
PlatypusRARBretinoic acid receptor beta [Source:HGNC Symbol;Acc:HGNC:9865]9258OMA, EggNOG
Chicken396266RARBretinoic acid receptor beta9031CGNC:8589Inparanoid, OMA, EggNOG
Anole lizard100562902rarbretinoic acid receptor beta28377Inparanoid, OMA
Xenopus100488600rarbretinoic acid receptor beta8364XB-GENE-481009Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    transcription factor    /    Retinoic acid receptor beta
protein    /    receptor    /    Retinoic acid receptor beta
protein    /    nucleic acid binding    /    Retinoic acid receptor beta
protein    /    C4 zinc finger nuclear receptor    /    Retinoic acid receptor beta
DTO Classes
protein    /    Nuclear receptor    /    Retinoic acid receptors    /    Retinoic acid receptor beta

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

The page will load shortly, Thanks for your patience!
NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      The page will load shortly, Thanks for your patience!