RBX1

Description	E3 ubiquitin-protein ligase RBX1

Gene and Protein Information

Gene ID	9978
Uniprot Accession IDs	B2RDY1 Q8N6Z8 Q9D1S2 Q9WUK9 Q9Y254
Ensembl ID	ENSP00000216225
Symbol	RNF75 ROC1 ROC1 RNF75 BA554C12.1
Family	Belongs to the RING-box family.
Sequence	MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	458860	RBX1	ring-box 1	9598	VGNC:9926	OMA, EggNOG
Mouse	56438	Rbx1	ring-box 1	10090	MGI:1891829	Inparanoid, OMA, EggNOG
Rat	300084	Rbx1	ring-box 1	10116	RGD:1308453	Inparanoid, OMA
Horse	100055581	RBX1	ring-box 1	9796	VGNC:22259	Inparanoid, OMA, EggNOG
Cow	518880	RBX1	ring-box 1	9913		Inparanoid, OMA, EggNOG
Opossum	100013521	RBX1	ring-box 1	13616		Inparanoid, OMA, EggNOG
Platypus		RBX1	ring-box 1 [Source:HGNC Symbol;Acc:HGNC:9928]	9258		OMA, EggNOG
Chicken	418001	RBX1	ring-box 1	9031	CGNC:9088	Inparanoid, OMA, EggNOG
Anole lizard	100566553	rbx1	ring-box 1	28377		Inparanoid, OMA, EggNOG
Zebrafish	449846	rbx1	ring-box 1, E3 ubiquitin protein ligase	7955	ZDB-GENE-041008-106	Inparanoid, OMA, EggNOG
C. elegans	179358	rbx-1	RING-box protein 1	6239		Inparanoid, OMA, EggNOG
Fruitfly	31014	Roc1a	Regulator of cullins 1a	7227	FBgn0025638	Inparanoid, EggNOG
S.cerevisiae	853986	HRT1	SCF ubiquitin ligase complex subunit HRT1	4932	S000005493	Inparanoid, OMA, EggNOG

PANTHER Classes
protein / ligase / ubiquitin-protein ligase / E3 ubiquitin-protein ligase RBX1

DTO Classes
protein / Enzyme / Ligase / Ubiquitin-protein ligase / E3 ubiquitin-protein ligase RBX1

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source