The store will not work correctly when cookies are disabled.
Protein or Target Summary
E3 ubiquitin-protein ligase RBX1
| Gene ID | 9978 |
|---|
| uniprot | P62877 |
|---|
| Gene Name | RBX1 |
|---|
| Ensernbl ID | ENSP00000216225 |
|---|
| Family | Belongs to the RING-box family. |
|---|
| Sequence | MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 9978 | RBX1 | E3 ubiquitin-protein ligase RBX1 | P62877 |
| MOUSE | 56438 | Rbx1 | E3 ubiquitin-protein ligase RBX1 | P62878 |
| MOUSE | | Rbx1 | E3 ubiquitin-protein ligase RBX1 | A0A2R8W6R3 |
| MOUSE | | Rbx1 | Uncharacterized protein | Q3V497 |
| MOUSE | | Rbx1 | E3 ubiquitin-protein ligase RBX1 | A0A2R8W6G1 |
| MOUSE | | Rbx1 | Uncharacterized protein | Q9D105 |
| MOUSE | | Rbx1 | Uncharacterized protein | Q3TWS3 |
| RAT | 300084 | Rbx1 | Ring-box 1 | Q498D8 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
